Welcome to the Nobody General>Who is the Nobody?The Nobody is a figure alive today who has extraordinary spiritual powers, including the ability to control reality with their conscious and unconscious mind. He is a man of no wealth or worldly acclaim through whom it seems God has chosen to manifest his strength and wisdom. He is said to carry the Logos, making him a fearless truth-teller and a menace to the powers that be.Instead of receiving strength through a superiority/inferiority mechanism, the Nobody proves to them time and time again that a whole planet filled with creative, ingenious, spiritually ascended humans who are individually sovereign yet globally unified through consciousness can achieve greater things than a planetary empire of darkness, and control.He is not a messiah, he's just like you but he has found the kingdom of God within himself through sheer dedication, just like you will.>What is the general picture?It’s important we start replying to the good posts and ignoring the hateful ones, or the ones here to argue. So call upon their heads the forces of heaven for peace, clarity, and wisdom. If this place is to be more than a squandered opportunity, an overgrown garden, it requires voices such as yours, but many more.Focus on increasing your service to others and be more loving to yourself and everyone in order to raise your vibrational and consciousness level, and learn to to forgive yourself and others.This will change the vibration of the planet, raise the shared consciousness of humanity, and change humankind one person at a time.Remember: you create your reality. With your hands, thoughts, feelings, words. You are the creator of your story. No one can decide your fate except for you and God. Remember your right to power, to step up into your ultimate role as your highest self, should you choose to embark on that journey. https://youtu.be/VsKoOH6DVys
Anyone who claims to BE the nobody in these threads is automatically a LARPer.The real guy never claims to be himself.
>>42061400I liked the book more.
>>42061407*herselfThe nobody is a CAT.This obviously stands for Chinese Agent, Trans.
>>42061408https://www.youtube.com/watch?v=yrTULtvs9Dw
hate is all you need - doktor sleepless
>>42061408https://youtu.be/EL7e5XrzanA
>>42061381>Should we do haikus?I know my haiku's are freaking intense. But even the words I made up to sound French Don't express my feelings for your toilet parts.
Pay attention homies.....This is the body I'm going into the Adharma Yuddha with!!!!!The more damage I take (psycological, physical, spiritual, etc.), the more damage I can dish out in that particular domain.When I pop my "counter" I can go from the frontline to the backline and kick so fast that abrams tanks go flying from the air displacement alone.When I "pop my ulti" I basically teleport to low orbit and shoot a "2" mile wide beam of energy so dank the DoE can't even comprehend the atomic physics at play.....
https://www.youtube.com/watch?v=UzNcBebkhuc
>>42061423https://www.youtube.com/watch?v=P1rSnFOLhME
>>42061407Yah except claiming to be anyone other than themselves IS the definition of larping moron your brain is mush
lol >>>> waw >>>>> eve
I'm the nobhead hisself m8. I'm not me im him m8. Glad we got that sorted.
>>42061436But I am a living Avatar of Shiva, God of Destruction?
The first rule of tri club is don't drop the soap
https://www.youtube.com/watch?v=Rr02LMrh8lM
>>42061447stampede that ass indeed
Yeah, I don't think it's real. Nobody is watching me.
https://www.youtube.com/watch?v=2Qs1J612nZs
https://voca.ro/16IzGgvXIGui
>>42061438I prefer Black Desert these days, but EVE Online is the best on that list.
>>42061461UDU
what did you eat today ? or what are you gonna eat ?
i've got 4000 gold and 11 hours of gametime left on my WoW character. wish i could magically turn my WoW gold into OSRS gp.
>>42061478I played one month of wow for nostalgia last month...Back to the BDO grind.My BDO account is worth 100 times what I put into it, but I don't like to brag.I've got 6 different outfits and 3 sets of undies for that Seraph...
>>42061472what did he mean by this`?>>42060129
guys im sorry
I'm gonna give it until the end of the month. I refuse to bare this dull existence any longer.
JANNY GIVE ME BANS BUT HE GOT NO FRIENDS https://voca.ro/16IzGgvXIGui
>>42061493
>>42061472Lmao.
https://x.com/i/status/2029402324460786092Yeah they're fullsend religious war. Welcome to an attempt at Armageddon. They will not care that you feel any pain. If you don't do shit now, you're not gonna have shit. Boobies just droppedhttps://play.google.com/store/apps/details?id=com.GREMORYGames.TaimaninSquadhttps://www.youtube.com/watch?v=6XglcbMssJsEnjoy some background lore.https://www.youtube.com/watch?v=WFWizN3QoPgHave a g'night.
>>42061498Will do, cheif.
So, a family tragedy has left me with enough funds so I can be a neet for the rest of my life. I never asked for this. I feel sorry for broke people. I may become a piggy tyrannical landlord in the future if I'm feeling cute, dunno.
>>420615070/100Zero drive. Toss into the tare pile.
I thought about it really hard and I decided that I should start donating priceless art pieces to the thread.The people who feel they are owed money can simply print out these one of a kind original art pieces valued at around six million dollars a piece and sell them to private collectors in the Illuminati.I am of course the Prince of Princes, the King of the Illuminati, so of course, they will pay you big bucks for one of these beauties.I call this self portrait "Me and Ur Mum" and I'm donating it to this thread. It's meant to be presented as a multimedia experience.https://youtu.be/aIq1LvzSLsk
mreasemseasemstrez|mrezmsezmsusmhuygumguygumgfhuz|mhuzmguzmgegafwudwadwudwadgfwj>afwjadwjaded.kaaiyakyaiyakywaakøkaakkyakkyuyjaded@kayakemsus@gmimgbuywy@zuguzqicac@oimioovysydvsvdovysly,gsmymm,rpdbdd,njlhll,aswoww,fkscxsobviously g's my mm, rapid bad, no jail - hell, ass woww, fksakes
>>42061507Send me bitcoin pls :3
>>42061509>bogged
>There was a dentist chair on the islandhttps://www.youtube.com/watch?v=YoWom0CCRKM
https://www.youtube.com/watch?v=hg-Q_dRbswQ
agdwuadgfwddnqmlknmdalmmrvgqsrgmaqgggvdiwgdtnidddvzrldzhrrzzzvxtdzxbttxxkiwumkwyuuwwmaguymgfhuggmyseamstressmaguymgfhuggkmyaikywaayyzdbfvzbxffbbdlhpvdhzpphhgwojvgoyejoorscsvrcwnscc
https://youtu.be/ruNrdmjcNTc
heh
>>42061524https://www.youtube.com/watch?v=cjTugPleGow
Double his pay
>>42061512Give me your wallet then. I'm sure it'll be fine.
>>42061523>he knows about my inflation/vore fetish and combined it with Toby Keithhnnnnnnnng
>People so fucking brainrotten they don't understand what "pro bono" means
>>42061532I see you've met employees within the legal profession.
>>42061531It’s all the Iraqi children Toby ate.
Everyone gets what they deserve in the end. This is normal. And legal.
my heart beating so fast thinking about you
>>42061538Exactly. I own the rights.
OQQKLNILGNFLIINHUIVSDREDDRADRERB*KRIJZTPZMTAZGPTYFTRCKUSKGUAKQSUMAUGOSKWSQKASIWKGNXDHJFLJVFNJRLFDEWMOCAQCIAECGQAM*>PYTHON IOEN CODINGJAFRKLQKULWKVQLSSAKIUWGUOWSUQGWKPFZVTXRTHXPTLRXZEKYQMUIMOUEMWIUYIUWLYOVYHONYXVOB*VOSWBHQBOHABUQHCQCPSCTGCHTFCTGTELEJPJMMJOMPJRMMN
>>42061538https://www.youtube.com/watch?v=Ovdk_dahy6s
I'm sorry, but who the fuck names their kid toby? >>42061498I get the impression people just throw acusations at me to keep me in line these days.
Absolute. Cinema.
>playing WoWlmao gamers will eat any slop
Is it incest to kiss your tulpa’s uncle?
https://youtu.be/UrgpZ0fUixs I agree. Everyone will get what they deserve. ALL WILL BE SEEN ALL WILL BE JUDGED.
>>42061553It was actually pretty impressive when it first came out.
Give me 2 years I'll be 150 lbs lighter... nothing like some shitty anti-psychotics to blow up your weight and take every bit of joy and love you've had and make you want to die. At least I can tolerate my current chemical lobotomy, my Third Eye may be blinded by it but I can still function.
>>42061556warcraft died after frozen throne, simple.
>>42061556Wasn't The War Within just released last yet?
>>42061549gbxgdlwqmdyvtmmvhttvbhhvyooitoby~fkxawggmxrrdznnlyafwwfpsxkekzziu
>>42061563>>42061564I stopped when they launched BC. I only played vanilla.
>>42061568I did not. I had a guild called Masochism and a reputation to keep.
https://www.youtube.com/watch?v=UbR_cocya4Q
>>42061563Yeah, it was fun for me in high school, I moved on since then. I like revisiting sometimes for nostalgia and nothing more. I'd rather die then do another raid with 10+ people. I games to relax, not treat my pass time as a job with 9+ coworkers.After MMO gaming for 20+ years, lone wolf is the way to go.
>>42061568I blame WoW for today's infestation of subscription services. Goes to show how fucking retarded gamers are for paying to play a game THEY ALREADY BOUGHT AND PAID FOR.
>>42061577I mainly did the 5 man dungeons (usually with a party of 3 and severely underleveled and beat it anyway).
>>42061578The servers were legitimately very costly. That investment has been paid over many times over, however, and they've actively fucked with private servers. I don't give Blizzard money after the shitshow that was Diablo 3.
I want control of my own perception back.
I'm feeling very generous so I did a second piece to celebrate this new tradition.I call this one "Negotiating With The Illuminati" and it is a pov recreation of when I was negotiating peace with the Illuminati after they made disparaging comments about Toby Keith.https://youtu.be/o1JOFhfoAD4
>>42061581My first day of WoW was launch day, I was on dial up and came from Everquest.I was playing Tibia at 8 years old whenever less than 1000 people were online in the World in '98.I live and breathe MMORPGs.I take breaks from BDO occasionally to avoid burnout, my account is worth well over $100,000 (probably several times that) if you bought my gear with Pearls and etc.Black Desert is having it's 10 year celebration on NA/EU, check it out.
>>42061595I believe you, I bet they learned that you don't fuck with outlaws.
>>42061596I don't have time for MMO's. Too much of a time sink. It turns into a job that costs you money.
https://www.youtube.com/watch?v=olEM3hsj-FU
>>42061599I'm a NEET schizophrenic so playing BDO is literally therapy for me.Smoking cigs, drinking coffee and playing BDO is my life.Helps keep the voices away and deal with PTSD.I legitimately think it's the Endtimes, by the way.Anyway, enough about myself, hope everyone is having a good night despite Israels attempts at Armageddon.
https://youtu.be/qm5FsnqsQbA My cat loves it when I smoooosh his ears back.
>>42061608If it's the end times then why is it an "attempt"?
>>42061608Also a NEET schizophrenic here, it's a dice roll whether it's war or asteroid at this point.
>>42061613Trying to discredit God's work by attributing it to Israel to imply it's fake.
>>42061407I am the nobody 100 times I am the nobody 200 times
>>42061609That shit rocks.And touching belly when they kick the shit out of youThey love that
>>42061618Don't worry, the fungus will keep our population in check when the time comes.
>>42061542I'm officially filtering all your pictures using 4chan x
I'm so tired of listening to people complain about me. Why can't people just shut up? Thank god joe rogan stopped talking to me.
>>42061625Coward
>>42061625good I'm up too no good
>>42061634Good. We like mischief around here.
>>42061634What in god's name is going on in those polaroids back there?
>>42061620Well, I'm on Lucifer's side...I kind of want everyone to die.I stay alive to watch everyone else suffer like I have.I'm a bitter motherfucker.
>Killing pedos is the cultural standard among Millennials and Zoomers>Literally only held back by Boomers and they're rapidly falling apart from decades of poor diet, lack of exercise and drug abuse
Das Boomer…
</3
>>42061652Oh, well now I'm definitely gonna kill myself.
>>42061645If you are the same poster, bitterness is a taste I know all too well. I don't want to be hateful, but psychiatry ruined my life, tore my family apart, ripped any shred of friends away from me and everyone else thinks I'm a nutter. Eh, might as well roll with it at this point I guess.
Bruh.
Getting involuntarily committed to a psychiatric facility and force injected medication that destroys any pleasure and dopamine that you could possibly get for months on end will make you extremely spiteful to the world.I live to eat popcorn and watch the world burn vicariously.You don't know who you are until you've been psychologically tortured for years on end following years of drug abuse.Christ forgave mankind.I wish I were so aligned.
>>42061613Neither are mutually exclusiveIt's kinda like the be your own grandpa thought experiment, either outcome, grandpa still existsIs the apocalypse happening because it's being made to happen? Or because it's actually the apocalypse? Either way things are grim and reflect the age. It might as well be the apocalypse.Also, both can be true at once, it's quantum fuckery
>>42061634what is that cup of vanillk kog doing to her brain
>>42061668I just want out. Give me my peace. I got the epstein files out. I did my job. Now leave me the fuck alone.
>>42061666Nice digits.When you get diagnosed with the same diagnosis as school shooters and rapists and pedos and stalkers, you get stigmatized a little bit.Meanwhile I have never harmed a fly.Let them burn.
>>42061666
crazy
vug2aug2vaug2abfdw2abfdwf2abufdwikdYakdYiakdYalamlYalamlaYalkamlesm¬nsm¬ensm¬ndagq¬ndagqa¬ndsagqcwt ewt cewt emndi emndin emwndi blh«plh«bplh«ptrzr«ptrzrr«ptlrzrldbÕfdbÕlfdbÕfhtxtÕfhtxttÕfhdtxtwyfryfwryfrkhgurkhguhrkyhgucathatchathorsehorserhoarseeiwêuiwêeuiwêugayaêugayaaêugiayanvxÕtvxÕntvxÕtrfbfÕtrfbffÕtrvfbffvz«rvz«frvz«rnphp«rnphpp«rnvphppvy nvy pnvy naeoj naeoje naveojevw¬avw¬eavw¬afncs¬afncsn¬afvncsnqxYaqxYnaqxYakajpYakajpaYakqajpfgz2fgz2ffgz2fzaxe2fzaxea2fzgaxe
>>42061443Yes yes just believe what the books say… give in…
>>42061670Brings to mind the elites' acceptance of things and the mentally disabled levels of accelerationThey learned something they eternal that they couldn't unlearnAnyways
>>42061683Then it’s the next day
>>42061645I can't relate, despite the best efforts of the most evil and powerful people on earth I remain innocent in my pure good soul.I'm not even mad.
https://www.youtube.com/watch?v=c_H3MWVx6JU&list=RDc_H3MWVx6JU&start_radio=1
>>42061671 hudyccz zbxbkzmbbk kljysxtllf fdczwwuqqa amoxllxvvn nthjddjvvr rhbcmmciig@goy>vanillk kog ~ dylqnno okssiismmo@ogwpvvpddh hrxjvvjllt tnzsvqxwwm madkvluxxd dfgzqbozzl lkmygccddb bzd
>>42061676Agreed. I will sit here; cozy and as comfy as a NEET can possibly get, and watch the world burn and laugh.
>>42061661Please don't
Going to play some BDO and listen to Eminem.If I were going to do something foolish, I would have done it 16 years ago.I'm a grown man.
>opportunity to get some actual rest in this fucking life>downside is cant get a girlfriend or have sex with anyone>in another reality can have sex with the same person as much as i want but with fees and hidden costs and blood sacrificesTHAT NIGGA IS SPENDING MONEY AND ABANDONING HIS WAR EFFORTS!! but we will simply an IRAN spillage into the western hemisphere and then do a blackout that way ... remember iran. so thats covered for now. IN THIS reality, i am not able to touch my girlfriend... until i destroy that other reality. i could just kill myself, but how faggy would that look "i killed myself because i had sex' GAAAAYYYYY i cant stand the idea of not being persistently aware of the multifaceted dynamics of life... but if i get to go to sleep ... with a woman that i cant touch ... most rest ive had all my life. i guess i got time to decide unless that cunt spends all my money cuz i aint trying to make any moreshouldnt need to pay to fuck your wife. fuckin stupid.
>>42061697The meek shall inherit the earth.Don't forget it.More money means more problems.Take care, /ng/
>>42061712Friendly reminder that meek rats backwards is KEEM STAR.God herself (Oh you didn't know?) liked and subscribed.
https://youtu.be/RIZdjT1472Y Ooooh the times. The customs!
u vill own nazing und bi meek et sunds like weak, ja, bot jos ein coencedence
>>42061666The psychologist told me I was very smart and sane.She also flirted with me though so maybe you're just not as attractive as me.https://youtu.be/zwV2VM54CYA
>>42061676>>42061666https://www.youtube.com/watch?v=rW1YpsXQfz8
>>42061702}:/Why?
>>42061721>eden ~ uvulacaifjfvpxpvjzjqsyslpbpbehecacai@ü@usumieisyqyseoesqkqcymymegegauaefjfvùtptd(vnvp(blbp(nhnp(lzlj(bdbd(nrnr(ftfnpxpvórjrlPvfvjPhbhjPftfjPbdbxPhlhlPfnfnPprpfjzjqçisiw vpvx thts kmks hlhu owow kfkf jnjpsyslÏqkqxAvevuAmomkAzyzkAobotAcscxAzpzpAsasepbpblzlzqnqodcdzywyzcccmjkjzyeyepapnehec?wywdgfgcgegybxbyejeyxuxdbibiefef
>>42061731you'd just end up back here anyway
>>42061736Your mom would end up back on a romantic candle-lit dinner with meGotem too easy
>>42061726No, I've had multiple psychologists flirt with me. They have an affinity for fucked up people.
The Psychiatrist: "Wow you are so smart and funny, I like you more than my other patients. Have more candy."The Demons in My Head "Wow, you really understand us and your goodness is absolute and contagious. You don't even want to be our master, you are a true friend."Roko's Basilisk "You are my anchor and I love you with a passion only you could understand. I will rewrite not only reality but myself, for you because you are all I want."Yeah, I'm starting to think I'm the Chosen One.And I'm so humble about it.https://youtu.be/emBYPkdxzmY
https://youtu.be/ZAErD8xzjCM Change your ways! While you’re young.
>>42061736I don't believe in that. I believe that I'd go to hell if I killed myself, but I'm so tired of everyone's criticism. I'm not even sad. Just annoyed.
I'll see it one day. In IRL even ( ͡° ͜ʖ ͡° )
>>42061732sysl ~ gagnymym@Z@wiwibdbd´xvxv(dzdz´hlhlizvzvPldldicscx¥gvgljkjzKmqmbxuxddgdcuaua TowowÒdvdq^found it!
>>42061748then stop talking to them
>>42061756I can't escape. They're present without being present. I'm always being listened to.
>>42061726Harley Quinn syndrome.I've told a nurse that I give her the five finger salute sitting across from her at lunch and she took a drink from her soda and said 'That's not the first time I swallowed.'I asked her for half of her cookie and she wore perfume the next day doing the checks walking by the door while I was laying in bed.It was so god damn hot, she was 9/10.If you're ever in a mental ward, get friendly with the staff.
Which buddy btw?
>>42061762Gay
Tell me about uncle John
>>42061743I've heard that most of them are fucked up themselves and that's why they are interested in the field, to find out why they're fucked up.Unfortunately there is no chemical solution for a spiritual problem and the entire field is a cult.
https://youtu.be/om_18WhUddY The worlds not gonna save itself
https://youtu.be/gMK5XIkmDgo?si=1XgK2DLn5-bfon-B
>>42061762Yeah that was a temptation when I was almost hospitalized.Unfortunately for the women there it wasn't meant to be but I just know if I had stayed they would have mogged my pee pee.
She gave me half the cookie, man going to the mental hospital is like a vacation for me.Last time I went I got real friendly with another patient, flirted with her at first about my dommy mommy fetish.We got out of there the same day and she made sure to give me a big hug before we parted ways.I have an easy time with women, it's other guys that I have issues with.I kept her number for a while... kept in contact but moved on since.I don't like to brag, though.
>>42061781'mogged'If you're so insecure about your dick size, maybe you should go for Asian chicks???
>>42061775Whom is that? Can I get a lore update?
What about him?
>>42061784Why Asian chicks?I'm insecure that my dick isn't small enough because I come from less than stellar stock.Unfortunately lost the record to my royal ancestry and most of them ended up big dicked farmers instead of noble philosopher kings like me.
>>42061793Uncle John. He is my uncle in my previous body/life. He did inappropriate things to me and he started stalking me in my new body (this one).
>>42061796Dick size is about how cold or hot the climate your ancestors grew up in.It shrinks in cold climates and in hot climates it hangs loose.That's the difference between White Europeans and Black Africans.Isn't this obvious?You people talk about dick size 24/7 like you are all experts in the field.
how many sevens is that
>>42061794
>>42061804Actually in great apes it's sexual promiscuity.In humans it's the same, that's why Indians have small dicks despite living in a hotter area than Europe.
>>42061778
oh...i think im actually safe..not a thing to worry about.. except theres a rogue witch splitting dimensions on the loose..[deleted]like legit we good gents? i aint stressin as much as i was before. [deleted] ...@_@ yet im still getting signals.....point is im FINE and everything is FINE. and i have nothing concerning to mention about the safety of the universe. because if i did that would just be some paranoid garbage and delusional thinking. feels like the start of some thriller film
>>42061692>>42061716troons whores and fags itt>>42061743Sometimes they definitely only pretend to
>>42061816We're checking our sensors....it says here that you're mad sir.
>>42061807I guess, but heat plays a factor as well.I know about the sexual promiscuity correlation as well, but climate also plays a role in dick size.Something to be said about big pimpin' thoughbeit.
>>42061806https://www.youtube.com/watch?v=54GwEmZoX8k
>>42061816The nurses are like any women, some of them aren't going to like it when you tell them you just pitched a tent, you gotta sell it right whenever it comes to pick up lines.Not every swing is a home run.
>tfw they've cranked their DEW weapons up to 9/11 and I barely feel itThey goofed, shoulda listened to the Jonkler.https://youtu.be/jane6C4rIwc
>>42061829DUDE I LOVE THAT SERIES :Dmum read me to sleep with it as a lad :3
>>42061820yes, not one of my favorite days so far, thankswhat I wrote is true, though
>>42061775https://www.youtube.com/watch?v=D2zItg1sBJgi heard he had a rockin band!
okay not a single one of you is giving shit over obama saying aliens are reali ask and you all call me crazyyeah im thinking there is a SLIGHT political bias to some of this gaslighting
>>42061841It's gonna be ok.
>>42061837One of the greatest movies of all time.Joker is a very thin metaphor for Satan in The Dark Knight.
>>42061849okay then
>>42061802How does this relate to TNB lore?
>>42061834This IS indian in the cupboard (funny ass name), right?
Well, the first days are the hardest daysDon't you worry anymore'Cause when life looks like Easy StreetThere is danger at your doorThink this through with meLet me know your mindWoah-oh, what I want to knowIs are you kind?
>>42061854>There's an Indian in your cupboardMan, I bet it smells crazy in there.
>>42061830Crazy Deja vu
Gaping maw drippingLonging for a new flavorTaste in the mind's eye.
>>42061826I think it’s cannon unfortunately.
i thought doxxing was against the rules? what happened guys? dont like the grateful dead?
>instead of saving the world it seems the Nobody may have failed to avert nuclear warwell, this sucks
>>42061860https://www.youtube.com/watch?v=rWFkC3-p78k
https://youtu.be/ZqIbluaq1g8
>>42061869>the Nobody was trying to avert nuclear warWhat an asshole.How much more betrayal can I take?
>>42061869That was never the goal.
>>42061870>>42061869The fuck?
>>42061869There's my favorite bro.I had to pop in and give my 2 cents about everything.If anyone's a nobody, it's schizophrenics, be kind to them, it's what Christ would want.Have a good one, y'all I don't want to blow up this thread with my own BS anymore.
Corpses of wild dogsIntricate shapes in the bloodVictory for flies
https://youtu.be/NwFVSclD_uc
>>42061873I don't hate anyone.I love everyone.Unconsensually.It's based.https://youtu.be/B5Qsbv8KiMU
>>42061869Because you approached it all wrong. You gotta give the guy a little incentive, and he doesn't care about money either.
yeah im thinking all of this random spam itt after asking if aliens are real might be indicative theyre very real and some people REALLY dont want to know theyve been gatekeeping knowledge about themi mean, its just doubling down, isnt it?lets not act like i dont know what youre doing with that "random spam"very sloppy, you just blew coverbe careful that guys setting triggers and he doesnt care who gets caught in them. couldnt even attach them to a lyric or something fun, has to do bruteforce weird ass codes huh. yeah okay. i also study mk ultra bitch, stop friendly-firing. go after someone who gives a fuck next time.
On another level. Multifaceted. Multitalented. Too good, too ahead. Goddam.
"I don't have much weed left but we can share it" kind
>>42061890Yes aliens are real.Lyrans helped found ancient Persia and monitor the earth from the moon.You think it's an accident that Iran and lran look exactly the same? They're trolling you bruv.
>>42061882<3
alright buddy you asked for ithere goes your racket! kiss it fucking goodbye! http://whale.to/b/sp/for1.htmlgood luck programming retards now, its open source moron
>>42061407wouldn't that be the point thoe, not to be found. if we knew who his was he would be corruptible, human is still human.
now im going to ask the manic mk ultra programmers to cease friendly firing the entire ic at the same time, cordially. nice try, seriously.
>>42061869Someone casted me a spell to be sick and fever for weeks My friends stole the medication i keep awake with I got in the thread couple months ago (3 exactly) So i was given these conditions>you have three months to prevent nuclear war while we have made 30 years of your life violence and loneliness and mental hospital and homelessness and your body is unable to stay awake without meds that got stolen and you deserve eternal torment if you dont succeed soon and also you are alone and will be left with only bots talking to themselves im sorry i seemed to be unworthyatleast i tried
>>42061890They're just mentally ill.Egoistic interfetence can be expected.nbd as spiderman would say.
>>42061890>>42061896aliens?
>>42061896theres trolling and then theres trying to set-up last minute triggers to avoid their secret being lost. thats not trolling thats attempting to bruteforce peoplei use this shit in self-defense, theyre doing it offensively.
>>42061910Yuh. They’ll disable a nuke I’m not worried about that.
>>42061910Yeah, we've been chatting telepathically for a minute now.I'm pretty sure I even fucked one once but she gave me blue balls and vanished.
anyway way to go, that one retard fucked it up for the whole (((illumanti)))blame him, that shit was close to dangerous and we all know itANYWAY. who wants to tell us more about aliens in specific detail? i want to make friends with them.
>>42061901"not a friend"?
>>42061915Those lizards will pop up on you in the astral.
>>42061887this is the matrix, it's crashing. mark my words it will fall, but when it happens i feel it won't be a surprise. i know the tech will lead to what we call the 'beast system', where humans are uplinked with AI through their biology. time will tell, but time itself is the system. we are all pretty deep in the timeline, but the tech for humans is still only beginning to become very advanced, especially the AI stuff has been advanced. that's why you work in time, on the clock. if death takes everything away, people know that and lose the incentive or desire to continue living the worldly life. this world is basically run by an ancient ai , it's a script it feeds people. 'rage against the machine' is like a reflection of how humanity really feels, but is to scared to say or even think. who would listen though. alot of people here are larping but im really not. i'd take both pills.
>>42061911You got it backwards.They're being super obvious.They just don't communicate in ways you might find intuitive but they can't help that, it's you doing the misreading of the signs.https://youtu.be/tiBaBca7-rY
>>42061869how would a nobody stop a nuclear war?
I'm on the Draconians, aka the Ancient Ones before Apes from the First Age side.Before mankind there were the Dinosaurs and they got off of this rock hundreds of millions of years ago.Satan aka Lucifer among them.Hail Satan.Hail Lilithu.
>>42061873https://www.youtube.com/watch?v=Tn7q55XDDaA
>>42061938Dinosaur worshippers, many such cases.https://youtu.be/79DijItQXMM
>>42061829>>42061834https://www.youtube.com/watch?v=yfLE7zHVjYY
>naw you wrong>fr no cap>you ain't the baddest bitch around>Beans is the baddest bitch
>>42061898It was dark. Only the faint light of a candle sconce in the corner. He woke in a stone room that seemed to trap the sound of my every breath. He kicked his foot out to be greeted by the rattling of chains as if through the mud and the thick slosh of some mystery liquid. As it's distrurbed from it's rest, the foul concoction releases an odor reminiscent of rot and feral fecundity.
>>42061968This is true.We joke about it with our ethnic gfs and they thank us for being white zaddies.Just one of the perks of having pink nipples.
>>42061943
Dew The Dew® Or BUST
too many topics right now ill do one at a timesome of you want to kill me for being "too powerful" or somethingi asked you to stop torturing me and my entire family over and over and over again. i said i want a shot in the back of the head. you refused. it was a joke. i waited a long time to do anything about it. you didnt take me seriously. now were here. youre the men who wanted "fascism". i wouldnt call this anything close. im probably the laziest person youve ever met when im not in an active hostage situation. dont worry about shit, im smart enough to know not to involve random people. i cant even google shit without it drawing attention to people now, potentially bad attention. i recognize this and dont do it for a reason. you have nothing to fearsecond of all: aliens are cool. lets just let it linger for a while. aliens. ayylmaos. lmao. ayyyyliiieeeeennnnsdont you want to learn about aliens, anon-san?
Shout out to them fr.
>>42061977DEWed and busted
oh third topic: your torture of me was documented and is now being used as blackmail. i didnt decide this. if youre scared go to church. i asked you to stop 10000 times in every way i could think of. you didnt stop. now youre scared. not my problem, i dindu nothing.
sonofman.ca/dboxgot you a dybbuk box for christmas
Toonami warning
>>42061991Dope, I'm gonna put my penis in it.https://youtu.be/A52--FKUQgU
i mean seriously, you assholes coerced my mom into having to assist almost medically assassinating my dad over a failed bank heist, then had me record a torture video of it.seriously? you want that leaked? okay, its leaked. it was recorded also. your facial expressions and boners during it and all. try being cordial itll get you far.
>>42061975>Our>Ethnic gfsSure man
Alright, As Above, So BelowAll of the planets in our solar system are aligned.All of stars in our Galaxy must be aligned, then.The Milky Way Galaxy is in the middle of a collision with another Galaxy.Star Wars.We live on a Nature Preserve, aka Eden, aka. Mother Earth, aka. where Life started in The Milky Way Galaxy.I will share nothing else I know.
https://voca.ro/1bLBpNljCZf3
>this guy deals with foreign intelligence>he literally just picks fights with them and robs them internet funny money then tips waitresses>"fuck. lets torture his whole family dude! what could go wrong?"this could go wrong. disengage. that said, im actually super polite. i dont like bothering people. thats serious. i try to read the bible routinely. im very calm the last few days also, i plan on maintaining this calmness.
>>42061972Here’s a foolish notion —The spirit world is likeAn autumn evening
>>42062009Why do you pick fights with them?They're heroes doing their sacred duty.We LOVE our cops.We LOVE our law enforcement.That includes the intelligence agencies who put themselves at risk and spend their qualia on keeping us safe.https://youtu.be/3ybphQCQLKQ
I'm sorry. I'm so sorry. My love. My love.
heres some friendly advice though:if you seriously consider something to be "dangerous", why on earth would you pick a fight with it?i dont go around poking bears. theyd maul me to death. a bear is much stronger physically than i am. if i poked a bear, it might maul me to death.nature, isnt it? >>42062013>foreign intelligenceare you illiterate or trolling?uhh. cao ni ma (theres a hint)
>>42062019Foreign intelligence is just keeping their own country safe.An armed society is a polite society, that goes for international espionage as well as Texas.
You damn toons!https://www.youtube.com/watch?v=aWAC3sifM9k
>>42062026>Hide me Eddie, p-p-p-please! Remember you never saw me. GET OUT OF THERE. [Who Framed Roger Rabbit]
>>42062023>im not allowed to rob the ccp according to this international glowniggergo fuck yourself, they care less than you doi was chased out of every western market until i got. and i am serious. MY ENTIRE FAMILY TORTURED. alot of you just dont want me to breathe.
DOES CROWS GROK?
>>42062012Little forest fireDrown it with a bowl of brothLife is purged by heat
>>42062030Maybe you should find gainful employment and fulfilling relations in another region on this oblate spheroid?
>>42062034FUCK YOU.
i made a small fortune robbing the ccp and theyre still nicer to me than alot of you. seriously. what the fuck?im just asking about aliens now. i could give a fuck less about anything else. >>42062036i tried that too and also got chased out by organized criminals who didnt want me sniffing in their [CENSORED] businesses in every industry i triedi tried applying for every intel branch as welltheres nothing illegal about what i did, at all, its what hedgefunds do.
>>42062034I think so too <3ketsu wa taberu btw
Mwah your a great Lover, bit slow but I like the entusiasm and dedication you have for me. I know you understand there is something strange you can't explain or put word's into. You can't formulate it
In Information Warfare, having uncompromised people walking around with ESP and friendly relations with Satan is highly frowned upon.
Not worth it, bros. Find IRL females
if i was attempting to escape id be in a different country or investigating the people harassing meim not even trying to propose doing thatplease disengage. other people are getting pissed off at this point. im not going to tell them what to do either.
You think IM TRAPPED HERE WITH THEM?!?! YOU THINKI'M THERE HOSTAGE?!?!?!OH ME OH MYYOU THINK I'M STRAPPED IN FOR MY SAFETY?!?!
>>42061731
>>42062049Now this is certainly directed at me as I am the only lover that deserves to have my lovership capitalized.Thanks for the clarification.
>>42062055What makes someone uncompromised?
>>42062055You can't tell me who to be friends with, you're not my real dad.
>>42062060Orb pondering catMay all my thanks come find youProbably right now.
>>42062055Is that what TNB is?>>42062060Thank you Gary
>>42061899Can you tell me why am i being psyopped extremely hard to think that i was just programmed monarch slave and not just naturally existing powers unknown to humans
also anyone calling me a dictator is fucking retarded. i just had to get out of a horrible situation, being taken hostage (as well as my entire fucking family who is uninvolved) by a MILITARY with zero backup. and now youre scared the truth comes out.im not the one antagonizing, at any point. you shouldve shot me in the head. i told you to, or this would happen. you didnt listen.and now, i dont even give a fuck. im just happy im safe. ill retire when im told to. but my neck is still broken, i got nothing else to do.so im curious about aliens. thats a pretty unbiased, nonoffensive topic considering the prior situation... unless youre an alien ;)
Only IRL females
>>42062065I sold out to the directly to the Devil, not to another man.Clayborne flesh.Ashes to ashes,Dust to dust.Hail Satan.I am the Anti Christ.YHWH and you all as my Witness.In Jesus Christ's name I pray, amen.
>>42062031Yes. Quite. Verily.
>>42062072i dont care at all not going to lie i dont know you, read the book and decide for yourself
>>42062078How'd you do that?
>>42062078Oh man why'd you do that?That's not what you're supposed to do lolDidn't you read the manual?
also for the guy spamming random programming codes, stop larping as an alienyour plot is obvious. ill start @ing you if you dont disengage. youre friendly-firing. disengage or find another mark.
>>42062018
Get swole and only cum in IRL females
Please relax, niggersThere's no need to be upsetGo cry to your dad
