The next Death Battle is The Sentry vs Superboy-Prime. Remember to report and ignore shitposters.
Sukuna wouldn't lose against Denji
>>153980476I don't know much of superboy-prime, but if he's a schizo does that mean sentry's psionics could mangle him? And can he do anything to nullify atomic regeneration?
>Unironically got country level sword I fucking kneel CSMchads...
JJKbros, we better hope to God that Sukuna gets a pity win against Muzan, or Yoru is violating us.
Post yfw>DOMAIN EXPANSION
Remind to the hulk/thor/sentry fag(singular), your heroes are cucks, your universe is cucked, your entire franchise is cucked
>>153980552It was very silly that Denji got off two nut kicks.
>>153980552I didn't understand this part here. Why the fuck did he say "domain expansion" too?
>kills everyone in this season and the last except for Hulk, Wile. E, and Simon (depending on if you interpret the retcon punch as time paradoxing instead of literal plot retconning) to death
>>153980476Tourists and crossboarders begone. This is /co/ country. Except you, Kratos. You can be our funny little jester.
SUPERKEKS OUR ENTIRE COSMOLOGY IS ABOUT TO GET GAPED WIDE OPEN.....AGAIN.... CAN WE CANCEL THIS EPISODE AND MAYBE GET GOKU VS SUPERKEK 4 INSTEAD?
>>153980507>but if he's a schizoHe's not.>And can he do anything to nullify atomic regeneration?Retcon punch.
Whats crazy to me about Denji vs Yuji is that DB proved beyond any possible doubt that Denji doesn't just win, he completely god-stomps and simply cannot be defeated by Yuji.He's equal in strength, if not superior, than Modulo Yuji, and so fast that Modulo Yuji literally CANNOT hurt him even in his his Human form.He also has access to every single Devil that's ever existed across his history and has an infinite access to them thanks to Hell door spamming and Devil Pawns, so he can literally just spam Devil eating for blood forever and has literally infinite regeneration and concept erasure.He resists all of Yuji's hax, He can't be hurt by any of Yuji's attacks, he hard counters everything Yuji can do, the only area where he wasn't completely dominant was in range, and even then Denji was shown to have superior speed and enough reach that he can just dodge/block/counter everything Yuji can do and was guaranteed to catch and kill him with ease, even pointing out that Base Yuji gets utterly obliterated by Denji. (and the black boxes also pointed out that if they gave the two fighters EVERYTHING, Denji would reach just as far, if not farther, than Yuji)All of this, btw, without once bringing in his high end stuff like the Universal AP from universal resetting, the Pochita eating a star devil, or even Pochita fighting all four horsemen and all weapon devils at once before the story began or eating parts of people to weaken them, all of which would have made it more of a stomp.Yet even with ALL OF THAT, they ended up downplaying Denji to a completely ridiculous and disrespectful degree, turning what should have been his ultimate, defining, final victory over an opponent who was never his equal to begin with and proving that Yuji is a fraud as far as being Denji's rival goes into one of the most hated DBs, to the point where he deserves a runback just to get the taste of that awful deathbattle out of fans mouths and put some proper respect on his name.
OREGONTOOOOOOOOOOOOOOS
>STATE SWORDS I DON'T SCALE TO! I NEED YOU STATE SWORDS I DON'T SCALE TO!
>Gun Devil>Nuke Devil>Flag>Every State as a SwordSukuna bros, I don't feel so good. OH SAY CAN YOU SEE!
>there are people who trust DB in 2026
>>153980571OH NO NO MARVELBROS BACK TO THE CORD NOW!!!
>>153980476Skipped Denji vs yuji So, what's the consensus on this matchup? From what I'm seeing online, people wanted that dude from homestuck or gwen to fight Superboy. This feels like the death battle team putting its own favorites over the fandom's.
Ya lost to a fucking coomer
>>153980552funny how they pretty much got denji spot on compared to reze and makima's episodes
IM SUCH A HAPPY DEFEATED LOSER KEK!!!!
>>153980552
I have a bunch of crying denji images that will now go unused cause he won
>>153980614Denji is more clever than he looks, he knew that pretending to have a domain would trip up Yuji.
>>153980614To psyche out Yuji and land a nut shot.
>>153980614To fuck with Yuji
Fuck...
>>153980552Shouldn't he have died in shrine do to blood lose? Don't really remember Denji ever getting pulped mahoraga style and coming back like he did.
>>153980507SBP fought both post pre/post crisis Superman to a standstill. Tossed around modern Superman around like a rag doll, and matched AM + Sodam Yar + BatKEK. Sentry can’t even beaten WW Hulk who was holding back the entire time mind you.
>>153980641It's not bad. Gwen would've been more interesting in the sense that the fight comes down to who's a better 4th wall guy. But as flying brick fights go, this seems to be alright. They're using sprites to so that's almost always a good sign.
>>153980571WARNING WARNING! WE HAVE A CANON KEK!I REPEAT, A CANON KEK!
>>153980651KWAB
>>153980663NOOOOOOOOOOOOO SHE WAS SUPPOSED TO BECOME MY GF
At least Goku isn't a cuck.
>>153980647Because beating women is funnier
>>153980654No he just said it to be funny. He's like that in the manga.
>>153980552Got a smile out of me. Denji and Pochita in general were fun as fuck in the fight. The Pochita charge was probably the best portrayal of a blitz they've ever done
All of the scrutiny around the state swords was so fucking stupidThey literally do this shit all the time, Yoru compressing an entire fucking state is if anything a legitimately more impressive feat than anything that like half the retards they jerk to multiversal have ever done
>DC character that only comicfags know about vs marvel character that was in like one filmfloppyroo
DenCHAD the GENIUS COPIED THE DOMAIN EXPANSION LMAOOOOO! DENCHAD DENCHAD DENCHAD!!!
>>153980571who is that watching?
>>153980648Sukuna would be happy Yuji died.
>>153980663We missed out on a new slut for the general...
>>153980499He would have lost too because DB won't let a series go 0-3. Look at Hulk vs Broly.
>>153980571Sooooo... Sentry is cucky? Cucky Sentry confirmed?
>>153980688FUCK YOU DIE SHUT UP ITS NOT FAIR ITS NOT FAIR FUUUUUUUCK!
>>153980688Cool. Then could we see the sword itself doing anything beyond building level?
I guess i have to thank god that they didnt go with the retarded universe level pochita
Where does kicking someone in the balls rank among Domain Expansions in JJK?
first time my preferred character won since ruby vs makai'm actually hyped bros
>>153980641It's an okay pick. It is a legit legacy match, anyways. Very popular 15 or so years ago. If it does well, they can bring them both back with other dance partners.
predict the classicman_d youtube short about this episode now
Wow fans on reddit are vocal about the result and they're not happy.
>Denji got the Kratos treatmentZAMN. Why do they do this to prevent 0-3’s now? Early DB didn’t give a fuck about loss/win streaks.
>>153980688It proves they're speed readers. Yoru literally states at the beginning of the manga that the strength of the weapon depends on the user's emotional attachment to it which is why a Denji sword could have been extremely powerful. She never said it was based on the size or power of what was transmuted. But, death battle had to appease the Denji keks. Denji and Yuji will come back in the future with more upgrades anyways so maybe there will be a legitimate country level feat to discuss in the future.
>>153980727They were also siding with Denji.
>>153980711Seeing this, is there any matchups for the other guys in the MHA class? Got anything for tape guy or tail guy?
I actually thought the animation for Yuji vs. Denji was good. I know a lot of people had problems with it, but I thought it was great.Even if you disagree about Yuji losing, given the power gap between the two it makes sense for Denji to take little damage. It also put Denji in some kind of a mentor or elder brother role to Yuji, and let Denji show how far he had come by defeating someone who had been down the same path as him. He wasn't just fighting Yuji, he was TEACHING Yuji. And I think that's very heartwarming in a way. That Denji would take the lessons he learned and help someone who was just like him, despite hating men.If this weren't a Death Battle I'm sure they would have ended cordially and taught each other well. The alternate ending is weird, even if heartwarming in its own way. It was nice to see Denji reunite with Power, but it feels weird to have him just die off-screen to Yuji and have Pochita reset the world.I haven't read Yuji's manga though (but after watching this fight I think I might watch a tiktok about it!) so I might be missing stuff but as a big CSM fan I thought they did Denji justice and from what I saw they treated Yuji with the utmost respect. What character has ever gotten an alternate ending made just for them?
>>153980727gayjustsu kikesen confirmed reddit
>>153980727why are you browsing reddit
Makima owes me lapdances.Makima owes me buttjob.Makima owes me lapdance buttjobs.
>Listtroon will seeth about Clark >Thinks PRIME TIME is Clark's Son>Non reader fag exposed > Goku Black is Gohan and Mega Man Classic and Mega Man X are the same person respectively in his troonhead>Will root for Sentry cause he's mindbroken about SUPERCHAD AND DCAnother one bites the dust
>>153980731Literally EVERY WHITE MAN in /dbg/ (and the rest of the world)
>>153980666Aging Devil, the entirety of the Yoru fight where they are constantly killing each other, human Denji spam regenerating when he got put in jail
>>153980692Sentry who came in to interrupt the fiesta
>>153980663TOLD YOU RETARDS KEEEEEEKK!!!!!!
>>153980476>Oregon Sword put at 32 Gigatons>Moon Spear put at 12.8% Speed of Light>Dabura/Gun Goddess put at 64% Speed of Light (and implied far beyond any character's reaction speed)>Deku was put at 362 Gigatons of TNT using only the embers of One For All and at actual Light SpeedWell it's not surprising, but it looks like DB has the ranking of MHA > CSM Part 2 > JJK > CSM Part 1.Also given the stats they used, they probably would have had to change the categories if Yuji did fully scale to Dabura
>>153980757Become trans anyway. Do it for the love of the game.
>>153980663JJKeks lost out on another grooming victim
>>153980740TolejoStar was a gift to these threads.
>>153980744>samefaceIf you like the females in the series you are gay.
>>153980476About time CSM got a win. (Reze should've won against Bakugo tho)
>>153980641The matchup makes sense honestlyPrime vs Gwenpool would be more fun, but people would assume Prime just oneshots her and that's that and would likely skip itPrime vs English isn't Marvel vs DCYou can tell from their last cast that they really want to talk about Sentry for an episode, and in that vein, Prime was his best opponent if they wanted to make another Marvel vs DC ep. Captain Atom could have been cool as well and maybe more thematic but doesn't have the "oh shit this guy's super STRONG" factor that Prime has. It's a bit disappointing but it'll be a fun fight probably.
>>153980739Maybe Iida vs A-Train or Sugarman vs Mother's Milk. But if they do The Boys vs MHA, I think I'd prefer Homelander vs All Might or Butcher vs Stain.
[DOMAIN EXPANSION]
>Solos your verse
>>153980749Needed outside help in all those fights btw. He got blasted by yoru once and needed a bystander to give him blood. This alucard style regen was something Denji never had (or makima even).
if Prime wins would that count as another Superman win since he's an alternate universe Clark?
>>153980641>This feels like the death battle team putting its own favorites over the fandom'sIt is. This matchup fell out of favor a long time ago, and Prime should win unless they decisively put Marvel's cosmology above DC's or they bullshit a resistance to the Retcon Punch.
>>153980748Truth nuke
>>153980786Makima had it cause of the prime minister contract
I FUCKING LOVE WINNING!Your "krasura" narrative won't stick because this is a legit win with less fuckery than normal. You're coping so FUCKING hard and it's HILARIOUS KEKAROOOOO! FUCK YOU JJKIKES stupid FUCKING FAGS I'm TIRED of your FAGGOT ASSES! I will LAUGH at you every time you show your sorry asses.
does oregon sword even count as a durability feat if it>A) cut him in half>B) happened in a world where death didn't exist as a concept
The CSM verse has country level durability buildings and streets? Holy fuark...
>>153980776?????
>>153980788>Sonic would become 1-2Ok
>>153980747>Superman was originally going to fight Sentry>SuperFAG Prime is stronger than Superman>Sentry is going to spread SuperFAG's ass wide open and RAPE him on screen for 3 minutes straight >Soft-Confirming that Sentry is stronger than Superman too and all of DC>Basically confirming SuperKEK is a fraud who should of lost all of those times against Goku and that Superman would have been humbled if he had to fight someone else Sentry raping SuperFAG Prime will be a fun rape to watch. I have my front row seats reserved.
>>153980788Do we count Game Sonic and Archie Sonic together?
>>153980796yea cause he wasnt evaporated from it also he matched its power
>>153980772They lowballed the state swords because it still gapes JJK, they also flat out said they lowballed the moon spear tooIf they calced the Oregon Sword like they calced Lobo compressing a city, JJK would be super raped instead of normal raped
>>153980641It is a very legacy match up. Gwen is recent. Lord English is less recent, and was the current favorite in the VS match up community.
>>153980796tupac is a bullet timer because he got shot to death
>>153980794It was a slow type of regen (look at how long it took for her to recover on the train). It's only instantaneous when she's chained to her followers. Never instant when not.
>>153980687Hope they do this one next, or Power vs Foo Fighters
>>153980796If Oregon Sword was too much he would have splattered upon contact with it but there's a panel of him hitting it directly and tanking its durability.
>>153980745 I like to watch sprite art and fags seething
The Asura vs. Kratos of 2026.
From what I'm seeing about the matchup Sentry has the edge unless Superboy Prime gets the retcon punch off?
Denji tanking everything sissyji throws at him was KINO
We were suppose to be keep laughing CSMfags because of the ending! YA BLEW IT DEATH BATTTLE!
>>153980641Pretty boring. Outside of shenanigans, Prime stomps Sentry and Sentry notably has no resistance to time fuckery. English would have been Prime's best matchup as far as debatability goes as he has resistance to retcon hax and packs time hax in spades
>>153980804>SuperFAG Prime is stronger than SupermanWrong.
>>153980628Why would he not scale to them?
So they'll backtrack on Gojo vs Makima now right?
>>153980796It's a strength feat in the episode. Negligible for defense but Denji managed to match strikes with it so he gets the strength scaling against Yoru who can carry a sword that heavy.
EVERYONE LAUGH AT THESE COPING LOSING KEKS!
>>153980827Prime beats the shit out of Superman every time they encounter. Superman is aweakling
>>153980832>JJK would have three straight lossesOH no...
>>153980772>G1 stats CSM would have been competitive with DB stats MHA (comparable strength and slightly faster speed)>DB stats CSM is 10x slower and 10x weaker than MHA
>>153980815It's kind of funny how Candy Elemental PB actually has a shot along with her OHKO weapons like the Battery Gun
>>153980720Sakuya vs my cock who will win
JJKfags are buck broken now. You guys were so sure you'd win but now that Denji won, you guys are assblasted bitches.
Imagine if the next matchup after Sentry vs Prime is another CSM matchup.
What's the next anime dude vs anime dude episode where one combatants is going to aim for the balls?
>>153980775Krasura was the gift that kept giving. It SHAPED these halls.
>>153980832>they scaled Yuji above the entire JJK verse >He still lost Denji unironically solos the cosmology
>>153980796Obviously not. The sword doesn't have 1 bajillion joules of kinetic energy when it was made with magic and clearly doesn't have the weight of a state
>>153980790what the fuck? To me, this popped up very recently. 2025 at the earliest.
>They will just wank and bullshit a fighter just so no more 0-3 situations happen anymoreWhy is current Death Battle like this?
>>153980844No. Mahito still would have gotten thrashed
>>153980807>yea cause he wasnt evaporated from itBecause it's a sword. It cuts things >also he matched its powerHe overpowered a startled Yoru. She gored Pochita when she hit him again
>>153980847I want to see Makima launching a full assault on the Candy Kingdom
This is the 2026 equivalent of Superman walking through Goku's Kamehameha. Absolutely disrespectful.
At leat now I know Denji could totally win against Naruto. He only had to split him from Kurama.
>>153980865>no more 0-3 situations happen anymoreCharizard didn't win last year
>>153980832Makima still lacks a counter to UV. You could still argue she could aim a bang at his head if you agree it gets through Infinity though.
>>153980796It doesn't, but Denji brought Yoru to her knees while she was holding it. this should have destroyed the city they were in btw
>>153980786>He got blasted by yoru once and needed a bystander to give him bloodDid not happen in the last fight with Yoru >Outside helpHe had no bystander helping him with Aging. They blatantly stalemated >Denji does not have alucard style regenHe regenerated his body 27 times while unconscious post fight without needing any blood
>Oregon sword has the combined mass of the entire state>somehow the ground easily tanks it and doesn't give in at all
>>153980832>Gun Devil is now a projectileShe actually does worse since she has 0 Part 2 scaling and her only wincon they stated no longer works
>>153980865…except for Goku and Charizard
>>153980852Time for me to become a good PUP for my BVLL DenCHAD! If I tim his asshole he may fuck Nobara's moldy flaps more than once per decade inbetween his Momo, Misa, Asa, Reze, and Power breeding sessions!
>>153980865Yuji is an overrated character anon, just accept it.
Powerscaling autism aside, CSM is just the better more entertaining story. Autistically explaining every minute detail of a power system is just a crutch for interesting storytelling
>>153980861He gets gaped by Takaba albeit
pochita after ONE nuke btw
>>153980852I see more CSMfags than "seething Yujifags." Yujifags didn't even show up in the thread before the episode dropped. CSMfags had more stock in Denji winning.
>>153980875Did they atleast have an heart to heart when yuji used his domain expansion or did Denji completely dominate the fight?
>>153980869Anon, I"m saying if Gojo had lost to Makima like he should have, JJK would have lost three times in a row.
>>153980899That nuke was country level...
>>153980901>Yujifags didn't even show up in the thread before the episode dropped.LMAOOO WHY DO YOU FUCKING LIE! GASLIGHTING KEK! Just admit you FUCKING lost bitch!
>WAAAAAAAAAAAH WHY DOESNT OREGON SWORD SHOW THE ENTIRE CITY BLOWING UPJust wait for it to get animated fuckface
>>153980901They FLED>>153980897Takaba is the true strongest of JJK
>>153980893And Denji is even less than that. Both suck, but Denji is away worse.
>Goku Black and fanficKU Will never get a DB episode like the next one>B-But Trunks-->Fight Fagon Ball lostHehehe
fight preview seems to have Literally Me 100% correct Prime instead of Pretty Boy Gwenpool but not an alphabet person Prime
>>153980875It's actually reference to Sukuna vs Mahoraga. Mahoraga tanked Sukuna's Shrine, and then Sukuna defeated Mahoraga with Fuga.
Remembered that a cordtranny pitched Poison vs Bridget for an episode and the honest-to-God description was "transfem characters with rope-like weapons" without a hint of irony (he had an anime girl with troon colors as a profile pic)
>>153980780And who the fuck asked for more Marvel vs DC???
>>153980832No, if anything is changed Bang doesn't go through infinity anymore
>>153980875Denji really should've died here. The blood lose should've made it impossible for him to regenerate.
>>153980899they didnt even have to bring up the nuke punch LOLthis fight wasnt even close
>>153980924Ambush bug has good matchups?
>>153980887>what is DB wanting to avoid any series go 0-3 Look at Hulk vs Broly. Just enjoy the fight. Prime vs Sentry is the real show. Even the comments on Yuji vs Denji are mostly about Prime and Sentry.
>Pochita TANKED the amped up sla.... AAAAACKKKKK!!
>>153980928Kino matchup and Kratos approved.
>>153980908There have only been three JJK eps. Makima beating Gojo wouldn't have changed Shiggy Diggy stomping Mahito.
>>153980925The preview from the event had him winking at the camera so be cautious
You know I do wonder had Yuji actually scaled to Dabura and his Speed they would have had to make Skill into a tie because otherwise the categories would be even since DB has never done characters being evenly matched in categories or even only taking one category but by an absurd degree (it was only ever briefly hinted at in Ichigo vs Yusuke)
If Yuji fought Dabura, he probably could have won.But that's not what happened in Modulo. Gege gave the scaling to Big Raga instead.Guess we know which author hates their MC more now.
>>153980884>Did not happen Because Denji TANKED it which is different from regeneration. >AgingYou're forgetting yoshida. >Regenerated 27 timesBecause he's a hybrid and he still couldn't do anything. If he had alucard type regen he would just pop back up in a instant without needing yoru and friends to gather his body parts together in a box like it's a toy to assemble it. Hell when he fought against katana dude he got cut in half and couldn't regen. He keeps this type of regen throughout the rest of part 1 and part 2. He just gets tankier.
>>153980925>me are le edgy shut up cringe bitch
>>153980910>wins the fight>has a mental breakdown regardlessWhat causes this?
>low balled moon spear >low balled state swords>low balled Gun Goddess >didn't even mention falling, the star devil or Mount Elbrus >STILL GAPES JJKIt was a good day
I JUST NOTICED.HE KICKED HIM IN THE DICK TWICE DURING THE FIGHT.DENJI YOU'RE AN ASSHOLE LMAO.
>>153980476>The next Death Battle is The Sentry vs Superboy-Primei sleepthis whole year has been a snorefestby the time a good battle is announFed i'll be like
QWhy are DCkeks acting so cocky when Simon already destroyed their verse last year? Guess they're excited for Sentry to do it again and Goku next.It doesn't make sense to me to get excited to be raped by men but seeing how many canonic faggots are in DC maybe it's what they want..
>they didn't even bring up devil eating, pawns, stealing blood from civilians, or Denji going to hellI hope you realize how fucking hard of a stomp this was. JJK's ENTIRE verse AMPED can't even TOUCH DenCHAD!!!
Toji TANKED Hollow Purple and rapes Quanxi now
>>153980972Prime would rape cucky Simon
>>153980945>heals it off in less than a panel >people say denji couldnt healtank yuji's domain
>>153980933Whole verse is regen merchants and they're even fraudulent on that front
Raped. Gaped. TAVGHT.
>>153980945>Shows him tanking it but getting hurt?
>Denji saving the day>Yuji decides to just kill off the batDenji used self defense. Yuji's death is his own fault.
>>153980972>Goku>still ducking Sonic
>>153980985Denji to Yuji.
>>153980931Why not?
>>153980969Don't worry anon next time will be scp-682 vs Doomsday
>>153980955Nobody in jjk is country level (logically) so no he would have still lost. But if death battle wanted to ass pull a win, they could have scaled yuji to yuki's black hole (mentioned to be planet level in a black box previously). But they didn't bother.
No, Naruto has defenses against energy splitting techniques. It isn't that easy.Ichigo on the other hand... big yikes against the JJKverse.
>>153980988It's not a death battle if the reason for why the characters are fighting isn't completely retarded.
>>153980997It's a projectile
So Lord English vs Prime joins Magneto vs Accelerator in the fights they should have done camp
FUUUUUUUUUUUUUUUUUCL HAVE MERCY IM SORRY FOR SAYING THEY WOULDN'T USE THE STATE SWORDS!!!! I KNEEL OREGON!!
>>153980571Sobbin’ Bob
Fuuuuu
>>153980997Because retards think Makima's bang is the same as Yoru... despite Makima not controlling the Gun Devil and two other characters also using their own version of bang
>>153980988Seriously whats his problem. Denji had to put down that mangy wild mutt for randomly going off and attacking people
>>153980972>GONOnlywinsagainstchildrenKU fat dreaming about SUPERCHAD
>>153980978The entire DC Cosmology was already gaped by GODmon. Move on anon...
STOMP EM IN THE NUTSSTOMP EM IN THE NUTSIMMA STOMP EM IN THE NUTS
I hear a verse shaking in its boots right now...
>Denji wins>Somehow CSMfags seem angrier
>>153980955They did put Dabura's kick at slightly weaker than Gun Goddess which was 1/3rd of the Oregon Sword...until you factor in Black Flashes so he probably would have lmao
>they're still trying to get me to care about tranime MU #1829482ENOUGH! IT'S PRIME TIME!
Is it true that Ichigo solos the entire CSM verse alongside JJK and MHA all at the same time?
>>153980813He wouldn't die from it retard. We saw Pochita regenerate from just his heart before
Well that was underwhelming.
wouls Goku be a good father to Bejita?
>>153980977JJKcuckies bringing a toothpick(RCT) to a NUKE fight(CSM regen)
>>153981037With wank yes. Sans wank he probably goes 50/50 with Deku.
>>153981034Because Denji winning won't change CSM's ending nor stop the next anime season from being mediocre
Since Yuji got cut in half when is Ash vs Denji?
>>153981037No. Shitch is a weak verse, barelly mountain level.
>>153981037Bleach's multiversal wank is pretty commonly accepted.
>>153981025>SimonPathetic.
>>153981056>nor stop the next anime season from being mediocreNext season isnt part 2 thobeit
>>153980796Bro they needed Denji to win to prevent CSM going 0-3. It’s not that deep. They did the same shit with scaling Hulk to entire Marvel cosmology. Just shrug, call them retarded, and move on.
death battle is the game theory of powerscaling and the only reason people don't see it that way is because of the animations attached to it
>>153981024Wasnt kid goku the one who fought gon?
>>153981034Well I mean at the end of the day Part 2 still exists.
>>153981040Sure retard, it's not like someone else comes in to help him afterward because he needed blood there. That definitely didn't happen.
>>153980476Death Battle is becoming lame recently.
>>153981064Cosmic Armor Superman vs Power of Love Spider-Man is a crazy MU. It's funny how Spider-Man variants would be better MUs for Supernan variants than Goku.
>>153980969What would even be a good match up in your opinion? Also reminder that we are getting Aether vs Aang at some point this year.
>Denji is 12% the speed of light, Dabura is faster than Yuji (even though Yuji said he would clean up if Mahoraga loses) and he's sub light speed (could be as high as 90%), therefore Denji is faster than YujiAmazing, also the black box is a little misleading, the fight with the strongest/most adapted Mahoraga gets offscreened towards the end so we don't know how it interacted with the light stuff as it became the strongest version
>Yuji lost to a sub country level jobberPeople actually think Yuji could beat Naruto? Lmao
Let the denjikeks take their victory lap. They were anxious all week worrying about their verse going 0-3. Let the children rejoice that death battle took pity on them. But, we adults will now discuss the REAL matchup in these halls now. Sentry vs Super faggot prime. Does Sentry actually have any feasible wincon? Will ultra guy read through every single piece of media relating to him to pull out a surprise W? Who knows. We can just hope that it's kino.
>>153980957>Because Denji TANKED itYup yup>YoshidaPochita stalemated with Aging before Yoshida was brought out >If he had alucard regen, he wouldn't need blood!He was cut up until there wasn't any blood left in the body. >Arc 1 Denji lost to Katana Man No way! >He keeps this type of regenHe literally gets his head cut off and just grabs it then puts it back on while in hell. He beats the hybrids solely because he just runs at them and regens everything
>>153981064This dude died to like a billion suns. Simon EATS those
>>153980875Denji decimated ALL of Yuji's hopes and dreams...
>>153981034Bro did you see their ending? After all that Denji still didn't score Asa's autistic ass.
>>153981072>*copes*
Guys! Yuji won! The getting kicked in the nuts competition.
>>153981037>1500x FTL vs 12% to 120% FTL>Multi Solar System level vs 32 GigatonsWhat do you think man, MHA is fodder for the Holy Shonen Trinity and CSM/JJK are fodder for MHA
>>153980571Niggas are a scourge on the earth.
OH YEAH BABYDENJI'S THE WINNERABOUT TO EAT A CHICKEN DINNER.
>>153981084Have they always taken money to let fans pick the matchups? If not then that's probably why.
>>153980875they made Denji say some cringe shit he would never say but this and slapping Yuji with his own arm was cool
>>153981004>Ichigo on the other handthe quincies split souls at a higher level than naruto's splitting techniques, bruva
What's next for CHADji? Which verse should he reap next? He got LOWBALLED hard here and still dominated easily...
>>153981102the holy shonen trinity are saiyan saga victims btw
>>153981089>Super faggot primeNice headcanon. Your hero, Yujiro Hanma, fucks and kisses men.
My balls got turned into dust btw
>>153981120CHADruto GAPES
>>153981124Yuji...
>>153981000>Death Battle realized that anyone scaling to Yuki's black hole was retarded but scaling CSM characters to Falling accidentally nearly destroying the planet was fair enough because Yoru beat FallingIt was that easy
>>153980615SP kills Simon to
>>153981102Oh? Is that so? Can you post the 32 gigatons feat Bleach has.
>>153981084we just got a kino episode though
Did they scale Denji's dura to the Oregon sword?
>>153981094>He thought the suns quote was literal
>>153981064>Drilled White Lanter amped CAS through the Source WallFunny
>>153981086>Also reminder that we are getting Aether vs Aang at some point this year.i've been too harsh, now that's a stinky
>>153980977Posting an attack that canonically killed Toji.
Say something to new Death Battle victor.
>>153981064He showed up in the match too and got DRILLED
>>153981135wdym? Prime vs Sentry is in late-June.
Yoru: >"Teehee. It's ok Denji you can leech my feats" Dabura:
>>153981133Um...well...
>>153981087They argued about Dabura and Gun Goddess having similar speeds but Gun Goddess (64% SoL) getting higher destructive potency due to larger mass. This would suggest they believe Dabura is faster than Denji but don't believe Yuji scales to him in any way.Looks like Modulo should have had Yuji fought Dabura instead of cutting the fight between Mahoraga and Dabura midway lmao
>>153981143
>>153981081>Misses the part where Pochita does not want to kill Yoru and he's already drained of blood so he runs away to look for either Power or blood
>>153981045Who tf is this redheaded bitch?
>>153981143I will honor this king by busting a nut to his harem of babalicious hotties
I watch Death Battle reaction videos.
>>153980990Sonic would lose faster than SuperKEK.
>DEKU..GOJO...DENJI... w-was I strong???No.
>>153981156It's absolutely funny as fuck how Yujifags were scaling him to fucking everything and hyping him up like the next coming of Christ when he never actually fights anyone of importance
haha no one scales to me :)
>>153981086Traveler at this point completely stomps Aang after getting Pyro gnosis in last Genshin update. Not to mention he'll probably get another upgrade this year too.
>>153980668>tdlrMissing the context as always. Superman don't lose where it counts, prime can't be the og completely
>>153980965His secret technique was the nut kick, so he expanded on it
Can your HERO tank this?
>>153981132You have that inverted
>he's still trying to get me to care about his anime MU>nobody is giving him (You)'skek, we're all waiting for the real Death Battle. >zoomer with too much power and an army of fangirls>literal boomer with too much power who gets shit for watching cartoons instead of the newsIt's a perfect MU. Bob and CK contrast each other perfectly.
>90% shonen including a literal twitter MU>disappointing execution of hyped up kickstarter MU>capeshit stomp is actually a welcome change of pace at this point>only great ep so far is the fucking sonic vs DB episodeis this the new worst DB season?
>>153981182He lost in the powerfag sense which is the matter of discussion here
>>153981178Even in Modulo he ended up being a fraud just like the entirety of the original manga
>Gemini _Generated_ImageIndiabros, listroon loves us!!!
Your hero would be unable to kill Morty in that special suit Rick made for him.
>Denji starts off nervously telling Yuji that he didn't kill the civilians Death Battle is 0 in 3 for writing CSM characters But I'll forgive it this time because Denji won
>>153981092>He literally gets his head cut offBecause he wasn't taxed consistently enough. This is something we see in every fight. If it's Denji attacking himself, sure he can afford to regen because he is a literal hybrid (which he keeps at the end of part 2) but when he's in a actual fight he's toast without consistent access to blood. Look at Reze vs Denji. She just blew up him in one hand till he was just a head and threw him aside like a toy. There are clearly limits to his regeneration. If Denji got hit by a world slash for instance, he's gonna struggle immediately to get back up. Moreso if he constantly gets hit by one.
>>153981174This is In-Character for Goku btw.
I'm very happy about winning but did anyone else think the 3d model for Denji-Man was ugly? Holy shit it looked cool in the manga but man did they fuck up adapting it.
>>153981086also for staters no twitter matches and no pity win-esque matches, reze and ichigo matches had no real reason to be in. all that man power should have been used to make megagru battle GOODfuck stomps, they've never been good
>Immediately after Denji wins damn near everyone starts talking about Sentry vs Prime Thought Denji winning would have a little more staying power.
>>153981143MYFUARKINGHERO
>>153981152maybe BUMji should try fighting his own battles instead of hiding away and letting others take care of things
>>153980887The ground has planet level durability
>>153981139Yeah. It isn't even a fight at this point.It is just an Aang execution.
I am ready for the next time. LET'S GOOOOOOOOOOOOOOO!!
>we now know a character will get whatever wank they need to get a pity winGoku will be beating Sonic if that ever happens. I bet they’re lining up a Charizard pity win too.
>>153981195Eh. The real perfect DC opponent for Sentry is Captain Atom. But Superboy Prime is a fine enough choice.
>>153981190Yeshttps://youtube.com/watch?v=mHLVDFbAPOQ&pp=ygUNS2FyZXRhIERhaWNoaQ%3D%3D
JJKbros... It's okay to lose, it's okay to be weak, it's okay to scale to your entire verse and still get neg diffed, it's okay for all of your has to do literally nothing. Please, calm down, be a better man.
>>153981223only the singular capefag and listroon care about that matchups
Modulo is fucking dogshit. Shart Poo's ending is better because it at least gives Denji the possibility of having a good future with a stable job as a devil hunter and potential romance with Asa. Plus, he rocks the eye patch. Modulo's resolution for the cursed energy problem was non-sense, and Yuji will end up becoming Sukuna fingers.
>>153980887The buildings also tanked the amped slash while Pochita didn't. The concrete is COUNTRY-LEVEL
>>153981213Denjiman was lame in the Manga too. Not even 1% of the badassery that Pochita chainsawman has. Hell even regular CSM with the metal arms is cooler.
>>153980843Superman doesn't get knocked out tho. Most likely he doesn't take him seriously.
So what I'm seeing is Yuji vs Denji is Ichigo vs Yusuke, but Yusuke won
>>153981254
>>153981211>She just blew up him in one hand till he was just a head and threw him aside like a toyShe blew him up a ton to overtax his regeneration, it was literally shown that he had no more blood. Every single time Denji can't regenerate anymore is when he has no blood in his body anymore Not like it matters either when Denji can just keep things in his stomach for blood too
>>153981253>*matchupaiiiiieee
>>153981223SBP meeting Spider-Man was cute especially when he looked sad after Peter told him off. But it sucks that he hasn't meet Gwenpool.
>PLEASE CARE ABOUT MUH CAPESHIT MATCHUP
>>153981254tRUTH NUKE
https://youtu.be/feNxXkHdZJ4?si=vlw8wMwEIujr3p9r
>Denji and Pochita vs Yuji and .....Wait. Where is Sukuna?
>Superman: I shouldn't have destroyed Goku and his brains, now he's a lobotomy victim that only can post ai images to communicate...
Yuji literally let a cancer patient fight in his place. Genuinely the biggest bitch in shonen.
>>153981232>It is just an Aang execution.A well deserved one after they did Edward Elric completely filthy.
>>153981180If I were Death Battle, I'd honestly just cancel the match up because no one really wants to see Aang just be curbstomped.Put Aether up against someone else if you really want him to fight.
>>153981278KEK
>people STILL posting about JJK and CSMLEAVE.
>>153981273I'll only care if The Light Bringer himself voices Superboy Prime.
>>153981277It's modulo yuji
Nayuta owes me buttjobs.Yoru owes me buttjobs.
>>153981280Gege: You rike?
>Sentry is FIGHTING the STRONGESTBased.
>>153981254>good futureThey still have no solution to death coming down and killing everyone. So no Denji's verse is on a clock.
>>153981296Hal...
The hierarchy of power for WSJ isYugioh (At Least 7D Infinite Multiversal)Bobobo (technically if you want to scale a featless Yugi)-Massive Gap-Saint Seiya (VSBW says this is Low 1-C o algo so I'll use it, but otherwise it's apparently 2-C)DBZMedaka (I mean probably? I think this is universal)-Another Gap-Bleach (Was placed at Multi Solar System)Naruto (Will probably be placed at Multi Solar System)-Gap-One Piece (It's Large Planetary o algo)-Gap-MHA-At least a 10x Gap but probably way more-Chainsaw Man Part 2Jujutsu Kaisen (did you know that Dabura is now by far the strongest character given DB's statements lol)Chainsaw Man Part 1DandadanKagurabachiVarious Axebaits and U19 slop
>>153981278It should have been more like this.
What was the last match where the cocky and arrogant cunt that started the fight actually won?
>>153981259I thought Denji-Man was cool. Mostly design but I like how he mindbroke Yoru and I loved the devil pawns. He did honestly feel weaker than normal pochita though, probably because he fought against way stronger guys. I wish CSM had another arc after Yoru.
>>153981301What reason does Death even have to do that in a timeline where Chainsawman never existed?
>PLEASE STOP TALKING ABOUT THE TWO MOST POPULAR ANIME FRANCHISES AND CARE ABOUT MUH CAPESHIT
>>153981223Well we've known about Sentry vs Prime for a week now, so there's not really a refraction period post episode.
>>153981277shibuya incident sukuna would genuinely be getting the bakugo vs reze treatment from part 2 denji
>>153981277>SUKUNA PLEASE SAVE ME
>>153981267Which means it's easy for a opponent of a similar level of power to tax his regen. Yoru in 1 bang move incapacitated him. Denji relies on overpowering his opponents while occasionally using strategy to win. Here it worked because yuji is like city level at max, but against stronger opponents outside of his verse he will fall apart.
>>153981201We're barely halfway through, calm down.
>>153981277Yuji and Sukuna separate in the story and Yuji was at his peak after separation. Maybe if you made some weird composited Yuji he would get Sukuna, but since they fight so similarly it would be a pointless powerup.
>>153980571Nothing wrong with cuckoldry.
>Death Battle admitted to low-balling the shit out of Denji, did not include half his abilities in the fight and did not use a single statement to scale him to characters like Falling or the Star Devil he ate >JJK's verse still got raped BRVTAL RAPING
>>153981264Denji vs Yuji is just Ichigo vs Naruto if you assume Ichigo just statstomps Naruto
I care about the CapeKINO.
>>153981254>Shart Poo's ending is better because it at least gives Denji the possibility of having a good future with a stable job as a devil hunter and potential romance with AsaDenji gets off-screened by a bug devil and Pochita kills himself while telling Denji he knows Denji is psychopath that wasn't happy with his two found families (literally the only redeemable aspect of his character was his humanity when it came to this) and instead enjoys suffering. Then Pochita uses his powers to retcon part 1 (the actual good part of the story) and Denji ends in a disney-tier timeline where he somehow still meets Asa and becomes a wageslave for Power and Nayuta. The "Man with a chainsaw" line is cringe as shit. And Denji canonically doesn't have an eye, one of his balls and other organs cause he sold them. Also the chapter literally has drawing errors cause the author was already done with that shit. The ending of CSM is really dogshit.
>>153981266Did the car just drive along the stairs?
>>153981213all 3dshit is ugly>>153981259shit taste>>153981316Denji Man purpose was literally ragebaiting Yoru with looney tunes tactics until she gave up and it worked
This was a fucking humiliation ritual.
>>153981232gacha battles shouldn't involve the mc desu. story progression ruins itjust think about itlike, you have to be a moron to go "uh, we're not gonna use luffy yet because the story is not over yet!" only to go "uh, we're using aether even though the story is not over yet"at this point aether vs luffy makes more (meta) sense than aang vs aether. lmao
>>153981317Thats just what she does regardless of chainsawman's existence
>Sentry >Would totally kill my dadKU Please win this!! I'll lend you my power!!?
>>153981338
>>153981138>>153981146That doesn't prove that Cas loses. Pic related is above even thought robot. So he beats sttgl extra hard.
>>153981327>Yoru in 1 bang move incapacitated himDenji literally just woke up and was drained of all his blood. Why do you think Pochita started out automatically low on blood?
>>153981345Post the CANON version, Pee.
You know, I can't help but notice that 5-Dimensional Low Complex Multiversal and the "We're calling these street tier" is where the most intense debates and autism occur
>>153981314Maka vs Ruby?
>>153981277Getting ready for his match against Frieren.
If they want the big view numbers with a gacha match they gotta bait the sex addicts
>>153981143Pity win
There are no more ongoing anime series to look forward to...
>>153981137Wait, so the suns weren't even real? C.A.S.is a fucking fraud lmao
>>153981301>They still have no solution to death coming down and killing everyoneThe prophecy already happened. There's nothing stating it'll happen again in the revised timeline
>CSMfag melty
>CSM>JJK>NARUTO ICHIGO VICTIMS
>>153981355It was White Lanter amped CAS. It was CAS with the emotional spectrum of the entire DC omniverse. (He lost to Simon not even using his ultimate form btw)
Kill all SHITnimefags.
>JJKfag melty
>>153981355>Beats amp'd CAS while not even in his most powerful state>This guy who is only even to that totally winslmao keep your weak capes in your own lane lest you get humiliated by /m/ again
>>153981361Keky!
Is there really no one else besides SuperKEK that deserves an episode against Goku?
>>153981025Simon loses to Superman some how by being more inspiring than being spiral power and unlocking hope trancendant energy
>>153981368>getting ready to use frieren's bisected corpse as an ona
>>153981201This is the definitely the worst season in terms of matchups we've had in a while but I think S7 is still the worst on that front.
>>153981368This is a funny MU to speculate because if Frieren gets a spell off she could turn Sukuna to ash but if Sukuna fires tons of Dismantles or opens Shrine Frieren is also just dead.
>>153981346Why didn't they include Yuji's nutshot? He's not above kicking someone in the balls.
>>153981386https://youtube.com/watch?v=ltfCMQeJ5NU&pp=ygUTSWNoaWNob2dvIHZzIG5hcnV0b9IHCQkjCwGHKiGM7w%3D%3Dhttps://youtube.com/watch?v=PcGoiNzAcxs
Denji's BWCYuji's broken non functioning TAP
>>153981398your saint seiya?
>>153981409Denji kicks people in the nuts way more than Yuji does.
>>153981334So basically if they just did a Ichigo vs Naruto over. Didn't they say some absolutely retarded shit in the Yusuke episode like Ichigo could destroy all of earth and hell with one swing of his sword?
>>153981419is fighting sailor moon
Are you ready for capeKINO?
>>153981368>Pretending like they aren't doing Sukuna vs Muzan and Fushi vs Frieren Muzan might actually beat Sukuna too
shitadoribros... dekuCHADs are making fun of us..
>>153981191Nah, Superman never loses to beings that are inspired by him.
>>153981368Nah, he's going against Piccolo Daimao or Muzan or Naraku
>>153981418Yuji has a canonically big dick based on Shoko's reaction to seeing it
>>153981352Knull would oneshot Prime btw
Alright, now it's time for the Chainsaw Man to fight the one and only Devilman
>Yuji would have won if he actually fought and scaled to Dabura (since he was placed at faster than Denji) and comparable but lower to Gun Goddess (the 2.5x multiplier would make it comparable but lower to the Oregon Sword)I guess we learned a valuable lesson about actually fighting to chainscale
>CHADSAWWWW MANN !!!!!!
>>153981143Still gets one shotted by Ichigo and Natsu.
>>153981421Not necessarily since Naruto will probably get retarded MSS scaling off Kaguya and alien friends and also similar 1000x FTL speeds at that point.Also yes, yes they did
>Oregon Sword can't even destroy a city>Somehow it's state-levelUh, sure. This is literally all I see people talking about elsewhere on the web, everyone knows this win is fraudulent...
>>153981451>HBOCtadori
>>153981304Where are you getting 7D Yu-Gi-Oh from? Not even VSBW wanks them that high.
>>153981443Akira rapes Denji though? Even with Oregon sword, Akira has moon level stuff
>>153981203Nope, Superman being the strange vistor proves this wrong.
>composite Goku vs composite SupermanThat's a lame match-up. Composite Spider-Man vs Composite Superman would be pure cape kino.>they start off at base >Spidey gets ragdolled, until he bonds with Venom and manages to push Supes back a bit>rest of the fight is Spidey and Supes cycling through the many different forms and power-ups they received throughout the years>Captain Universe vs Superman Prime One Million>King in Black vs King Omega>Beyonder vs Strange Visitor>Power of Love vs Cosmic Armor>Cosmic Comic vs (I'm not sure if Supes has an equivalent to this, but I'm sure he does)>ends in a stalemate because DB concludes that DC's cosmology is equal to Marvel's
>Sentry posters have been wanking their guy for so long only for him to be stomped in his debut matchFunny
Yuji getting fucked over because his author hates him is the funniest thing about this death battle.
>They talk about repeated Black Flash combos>Yuji only hits Denji with one or two combos even when he could get more inWhat was the point?
>>153981444They admitted to low-balling Denji's stats while doing calcs. They didn't even bring up the star spear Pochita intercepted They were saving JJK from getting exposed
>>153981444As if Gege could ever lose to Fujimoto in a "who hates their own MC more" battle.
>>153981472Composite Goku should fight Composite Kunio
>>153981451>Pity win Ichigo
>>153981466Wouldn't that be Lucifer? Akira barely dodging a moon slicer doesn't give him moon level durability
>>153981409Because nut kicking is Denji's signature move
>>153981341And it's still better than Modulo.
>>153981483Anything to not let CSM go 0-3.
I'm WEAK, and that's okay. I'll never be strong, and that's how it is. I accept myself for who I am!
>>153981483I thought the final fist barrage was intended as a black flash chain? It just didn't matter.
Dabura and Yoru, Denji's greatest allies
>>153981494Does that really matter? Denji has even less of a case to scale to the state sword than Akira does to the moon busting stuff. Like, at least Akira was actually holding his own against Satan instead of getting mangled every other attack
>>153981466>No star level stuffI HATE WEAKLING
>>153981484What is supposed to be impressive about this?
Denji won.
>>153981509It's just like what Yuji says in Modulo. "It doesn't matter."
If only I liked jjk or csm id want to watch this ep
>>153981355>White Lantern Cas =/= Real CasYeah no.Superman > Simon
>>153981358Gonna need context for that considering Denji refeeds all the time. But here's a scan for denji's low combat survivability. Even in a world where death no longer exists he needed blood to come back. And keep in mind this is at the beginning of the fight, before this Denji (or pochita rather) has 1 good regeneration feat where he returns from being split in half.
>>1539814657D at minimum was the stats they gave Yugi in the DB Q&A
If you haven't read Chainsaw Man you should btwIt's the best shonen by far
>>153981431>Fushi vs FrierenWho tf is Fushi, I hope you don't mean Fushiguro
I can't believe girls like losers like denji and not mysterious apathetic hoodie wearing guys like me
Makima and Reze dual mouth assaultReze rimming from the back while Makima irrumatio's the front
Akira exists after God resets the universe so his durability scales to it and is universal
>>153981431>Muzan might actually beat Sukuna tooKek, no
>>153981387CAS is above the emotional spectrum and it wasn't beaten.
I'm happy for CSMfags, really. I mean sure JJK outsells CSM by a multitude of about four, CSM had one of the worst endings in modern shonen and it will forever be mocked for that, and the art turned into scribbles halfway through...but hey, at least they won this fanmade battle. So that's something, right?
>>153981099Country level KE that can't break concrete fuark.
>>153981476I remember that autistic faggot on Space Battles, I wonder where he is now
>>153981431Definitely not. Muzan sucks
>>153981465Also pretty sure VSBW remarked that their current profiles on Yugioh are ass so they're not reliable lel
>>153981538I'm so lucky...
>>153981536Girls love guys who are energetic.
>>153981535he's from fumetsu no anata
>>153981506Symphogear death battle when?
>>153981533hopefully his popularity will have writers making interesting MCs and plotlines instead of le power of friendship cardboard cutouts like naruto and luffy
>>153981549>jjkek talking about bad endings>jewjewgaykek talking about bad artSurely a jest
>>153981393You don't have the feats to prove your claim that Simon can overpower king omega Superman, so that's that.
>>153981137Oh yeah a hyperbole...Wait what?
Are there even any primebros in here?
>>153981486Who's Kunio? I'm not familiar with him unless you're talking about River City Ransom/Kunio-kun.
>>153981519>Spear either being shot out of a star or is far enough from the portal that it's as far as the stars >Pochita intercepts it right at the moment when it's about to hit Kobeni >Makima says Pochita would still be able to easily dodge it despite being weakened I dunno, seems like the average Friday for Pochita
>>153981536Girls love ugly pathetic mouthbreathers who eat scabs and toilet paper, are missing one of their balls and offer other men rimjobs.
It's funny how JJK and CSM have the same score, but only one side is acting smug about it.
>>153981567This and also MCs that aren't herbivore cucks
>even the chainsaw man glazers on reddit are calling state sword scaling retarded How bad must you be to get the fanboys of the series you're wanking call you on your bullshit?
>>153981533Its just depressionslop. All the interesting characters just get killed off.
>>153981201>>capeshit stomp is actually a welcome change of pace at this pointNo it isn't nigger, what?
>>153981567What exactly is interesting about Yujeet besides the fact that he is your self-insert because you are also a porn addicted poorfag loser?
>>153981589It's Death Battle. This isn't a new thing.
>>153981571I never saw a flood of memes making fun of JJK's ending.
We're gooning to MAKIMA, POWER and all the CSM baddies tonight CHADS!! CSMBROS STILL KEK YUJIKEKS BTW!!
Reminder Sonic RAPES and GAPES Goku and his entire verse
>>153981583>>153981536Reminder this is how DenCHAD looks like canonically>>153981589>jewjewgayREDDITOR seethingKekaroo, go back btw
>>153981567Chainsaw Man as an IP is basically disgraced after that shit ending. No mangaka is going to try to write their MCs as Denji.
>>153981531>Denji refeedsDenji did not drink any blood after waking up. At most, he ate some sushi and got jacked off>But here's a scan for denji's low combat survivabilityHe literally regenerated from this without needing to drink blood
>>153981549Holy fucking cope. You JJKeks spammed for a month ago how you'd win and now you pull this shit. Pathetic.
>>153981431I think Frieren should fight Thistle from Dungeon Meshi
>>153981582Kobeni was able to perceive and react to it. Guess Kobeni is also MFTL.
>>153981201Nah S9 is still the worst. I take this over perpetual capeslop
>>153981611People didn't think DB would pull another Kratos/Asura to give CSM a pity win.
I just wanna mention this that even in this death battle between Yuji and Denji. MHAfags are still trying to fucking insert themselves into it for no reason.
>>153981597>Makima She jobbed albeit
>>153981595Because JJK has no cultural relevance. Its numbers are only propped up by fujoshis shlocking themselves to gay pairingsPic related. JJK has 0 women in it and even Tite Kubo called Gege out on that
>>153981584To be fair, Makima and Gojo are from their respective Part 1 while Yuji and Denji got EoS shit.The CSMbros claiming this changes Makima vs Gojo are 100% coping though lol, "what if the only wincon they gave Makima in Bang didn't work anymore"
>>153980690>Booster Gold vs Cable and its millions of views out of NOWHERE
City level Denji still beats p1 Yuji. If Yuji is smart, he would trap Denji in his domain and beat him there. But in death battle the characters must act stupid and ooc, so Denji kills yuji by stabbing him with his chainsaws.
>>153981602I look like this btw
I had no investment in either side but the shitposting would probably have been funnier if the reverse happened.
>>153981628More cultural relevance than CSM and nearly 100 million more in sales.
>>153981593Yuji is bland as fuck no one denied that?
>>153981628>Because JJK has no cultural relevanceHoly cope. Gojo dying broke twitter and a shit ton of new memes come from JJK
>>153981582Pochita couldn't even react to the Gun Goddess bullet going significantly slower than your wank portal spear. Why are csmfags so terrible at scaling
>>153981634He did that in the animation. Denji just dealt with similar shit
>>153981564
>>153981612I don't know who that girl on the left is but she looks cute as fuck and I want to fuck her.
>>153980552This episode was so fucking cool man...
Seeing this episode where the characters actually physically interact with each other reminded me of Dante vs Clive where it's just both characters taking turns to swing particle effects at nothing
>Planetary hills>Multiversal boats>country level swords that can't break concreteGod fucking dammit, the pity wins are out of control, unironically the only one who had a non totally wanked pity win was MHA, HOW
>>153981615>Reaction scaling Yes. She was fast enough to look at the portal and shriek in horror! Great job digging for that anti feat!
>>153981620They didn't. They only used reasonable scaling and feats from both sides and wanked both of them.
>>153981639After the flood of spam CSMfags posted the last few days, seeing them lose would've been ten times more hilarious.
>>153981584Look Denji doesn't have alot going for him right now. He's missing a testicle, he works a 9-5 again, and he's Power's bitch at the moment.Let him have this.
>>153981625>She jobbed albeitTo Denji btw>>153981641>>153981645JJK was forgotten the moment it ended
>>153981602He looks like he enjoys the company of black men.
>>153981624Mha, jjk, and csm are the same series in terms of them kinda being a big 3
>>153981602please stop letting us know how gay you are for saving pics of fruity looking fags on your computer
>>153981644Oh I mean Denjeet the pathetic loser bum MC and not Yujeet the bland loser bum MC. I always mix them up.
>>153981666>Power's bitchYou say that like it's a bad thing.
>>153981549Yuji has no memorable things about his character while Denji is the most memorable thing in his series.
>>153981472Composite Supes RAPES and GAPES composite Spidey without giving him a chance to do anything.
SLOW DOWN!I CAN'T KEEP UP WITH THESE THREADS!
>>153981668It's not even over, it has a sequel series going on, so...
>>153981602I'd watch that dude get pegged, no homo
>>153981669Do jjkeks really?
>>153981625>I wanna fuck MAKIMA>JJKeks think about Gojo's man buttI didn't mention Makima vs GOJO, you did. We're not the same!
>JJKjeets mad that Denji rightfully won
>>153981610A bystander literally came up to him and gave him her blood. Infact he has to rev himself up and become denjiman after fooling the low IQ yoru to not attack him.Don't remember Denji being drained of blood before the aging devil arc, but it doesn't matter.
>>153981628Anon I...
>>153981615HOLY FUARK KOBENI SOLOS THE JJK VERSE
>>153981670True but it does get obnoxious when they feel the need to insert themselves like a third wheel.
>>153981675It is when the bitch doesn't bathe and doesn't know how to wipe her ass properly.
>>153981549>I mean sure JJK outsells CSM by a multitude of about fourReze's movie mogged JJK0.>CSM had one of the worst endings in modern shonen and it will forever be mocked for thatModulo was rancid and even JJKfags hated it.>and the art turned into scribbles halfway throughHave you seen the first part Maki vs Sukuna and Rika carrying Yuta away from the battle? Gege's art was scribbled, and Gege's art has gotten WORSE. Look at pic related.
>>153981675Time was reversed before power knew how to bathe herself and flush her shit. Denji is 100% cleaning up stray piles of devil poo everywhere he goes.
>>153981687I don't like either shows.
>>153981647>Bloodless and injured Pochita got shot in the back by a gun devil attack when he was explicitly not trying to fight Yoru anymore Gun Goddess is now the anti feat JJKeks are using after getting gaped by a lowballed Denji. SAD
Don't really understand how abilities was tied when Denji's only "win" over Yuji is his healing which they admit is limited by blood. And his healing is only good enough to heal his whole body single digit amount of times, usually from some part of his torso still intact. Even without the blood poisoning mattering (which, I have no idea why Denji's poison resistance matter here when it's not a real poison, it's just magical blood aids), Yuji can makes his blood explode. Denji attempting to drink it should be another opportunity for Yuji to attack and keep him from regaining his blood supply. Yuji should've won abilities and won via DE cause Denji would run out of blood from being turned into blood mist a few times. Also this enter the part of AP which is weird cause Denji got scaled to two attacks he doesn't scale to in absolutely any way and they limited Yuji to his shitty dust cloud when they previously went as far as scaling Gojo to fucking everything in the verse.
>>153981678Doesn't Spidey get Heart of the Universe or something at that point for muh composite marvel cosmology nonsense? At that point its just "Marvel Cosmology VS DC Cosmology" and they flip flop on that constantly.
>>153981648Denji called in yoshida to help him out?
>>153981674Surely not, if you did you don't know anything about Denji or is just a castrated redditor that gets the ICK anytime hot women shows up
>>153981697Shit.. that made me laugh
>>153981670But MHA is way too old to be part of that big 3. Demon Slayer would fit better.
>>153981610>He literally regenerated from this without needing to drink blood????????
>>153981679Right now the Death Battle threads are probably the second fastest on the entire board, losing out only to /pw/'s WWE threadhttps://4stats.io/
I haven't been this satisfied in a looooong fucking time.
>>153981670>big 3There's only the big 1 in this gen, and that's Demon Slayer. MHA/CSM/JJK all share second place.
>>153981708>Denji got scaled to two attacks he doesn't scale to>when he specifically was attacked by those two attacks Ok man
>>153981678I think at one point Spider-Man literally had the powers of The One Above All so I doubt it would be that easy.
>>153981722yupthe first good episode of the year
>>153981722This. I feel like rimming another dude's ass now after seeing my GOAT Denji take the win.
>>153981722This shit just made me realize i really miss Denji
>>153981722thats kinda sad
>>153981708I think their argument was that Denji would be too strong and fast for his conventional abilities to matter. Had they matched in both Power and Speed they probably would have given Yuji the edge in Abilities (becsuse otherwise the tiebreaker would be fucking Skill), and had they matched in only Speed I'd imagine they'd have argued for a Tie in Skill and then Power as the sole tiebreaker
>>153980924wtf he's literally me
>>153981737Do JJKeks really
>>153981691Denji was drained of blood by public safety when they were cutting him up for a week. Denji refeeds on blood using the tree from the Aging World Every fight Pochita had after Nayuta's death was him and Pochita low in blood in between
>>153981728Demon Slayer has been forgotten about fast. Like the hype died down bad outside of Japan.
>>153980942Gwenpool
So JJKfags what have we learned today?
>>153981750JJKeks are so fucking gay. They always talk about rimming mens' assholes.
>>153981750Context: JJKeks have been spamming that throwaway gag panel with YoSHITa for the last MONTH. They are SERIOUSLY homosexual.
>>153981755You say this when the latest movie just btfo'd all of Hollywood globally.
I do not like Superboy Prime fans. He is a very reddit-coded character. Superman if he were reddit if you will.
>>153981687Canon.
>>153981549>the art turned into scribbles halfway throughJJKfags are never going to beat the allegations of having never read their own series. And Gege's recent art is shit too.
>>153981760That you can use math to wank shit, even if the end feats are a gazillion times weaker than the calcs?
>>153981765>>153981766Grim
PUNK ASSBITCH
>>153981760That we are not Oregon level.
>>153981766Seriously this waiting period was so funny. CSMbros posting feats and having discussions while JJKautists are spamming rimming and cuck jokes
>>153981760That deadpool has city level durability because he regenerated from a nuke that reduced him to ash
>>153981780>S-Stop mocking me!!!
>>153981760That buildings are country level
>>153981751Yeah, but for the final fight he literally ate the death devil and a bunch of other small ones so there is no reason to assume he wasn't operating at full strength. It's just too easy to tax his blood system. Granted, a small bit of blood is enough for him to recover which is something he exploits in virtually every fight in part 2. But it's still a big weakness of his.
they should just confirm Aang vs Traveler got delayed already thanks to the new movie
>>153981785...in my CSMcuck fantasies.
>>153981708>And his healing is only good enough to heal his whole body single digit amount of timesHe healed at least 27 times while unconscious btw>It's magic poison That's never differentiated from normal poison. Plus it's featless>Yuji's blood can explode Ok. Denji tanks it. >HE DOESN'T SCALE WAAAAAHHYes, I love the seethe.
>>153980615Prime obliterates Hulk, Simon and Wile E with ease.
>>153981782>Denji has more fun united states representation than Deku's series of just spamming names
>>153981797aether is getting his final element this year so they are probably waiting for that
>>153981755Demon Slayer mogged Fantastic Four, Sonic and Superman in the box office. The only heroes who have beaten Demon Slayer in the culture war are Mario and Spider-Man.
Gun goddess wipes out the entirety of the JJK cast including Gojo
>>153981776What the fuck is this scribble shit made by a retarded toddler?
>JJK 0 lost to CSM Reze Hen>Yuji lost to Denji
>>153981143He has the honor of being the only winner with a good episode this year
>>153981785>CSMbros posting featsI was so fucking tired of arguing against the oregon sword, jesus fucking christ that was mentally tiring. Almost every thread.
>>153981812>has travel speed>finite roundsLight work for GODjo
>>153981760That Death Battle doesn't know how to scale or analyze feats?
>>153981732 He got gored by both attacks, and never matches Yoru blow for blow. There is like one panel where Yoru blocks one of Pochita's attacks with the sword, and there is no indication the sword was damaged in any way, and then Yoru does another attack that gores Pochita once more before Fujimoto forgets the sword exists. >>153981743>I think their argument was that Denji would be too strong and fast for his conventional abilities to matterThey do argue that even if Denji is faster that he would still get caught in the attacks and be forced to tank them in the abilities section, though. Anyway, the tie in abilities was just for vibes for sure. They should've just said that plainly.
>WHY WHY WHY!! DID I HAVE TO DIE DIE DIE??????
>>153981815>191.4>191.1Yeah you can really tell CSMbros really needed this
In a few days we will be getting the final volume of csm part 2, so we will know if denji has a chance of returning in the far future or not soon.
>>153981796>he literally ate the death devilHe only ate the Death Devil. And she didn't have blood because she emptied out her body. Pochita and Yoru kill each other non-stop after thisOnce Denjiman comes out, he starts eating devils but then he gets jumped by Yoru and Seraphim. Then he reveals he kept a bird in his endless stomach in case he needed blood so I don't think Denjiman would ever actually run out of regen again
So update JJK bros, after Denji beat Yuji I started instinctively shoving fingers up my asshole. It felt really good surprisingly, although it smelled bad. I washed my hands and took a cucumber out of my fridge and started riding it. That was quite possibly the best experience of my entire life. I didn't know being gay was so amazing! Then I accidentally grazed my prostate and shot out a thick rope of cum! You have to try fingering your ass. I can't wait to be a sissy and service a BVLL!
>>153981834Cope. CANON Battle is always right.
>>153981831Gojo can barely tank his own purple
>>153981807>he mentioned Superman and box office in the same postUh oh someone is gonna have a melty.
>>153981848JJK has a production committee, CSM doesn'tCSM made much more money
>>153981813>shit made by a retarded toddlerIf you thought Shart Poo was bad, wait until you hear about Modulo.
>>153981849what do you mean?
The animation this time was alright, so what the fuck went wrong with Gru vs Megamind
>>153981845I'd imagine shit like the soul damage and dismantle would have had Yuji's power to be equal for them to give Yuji Abilities, since the statgap means they could just argue about Denji's durability allowing him to resist those or whatever
>>153981785>FeatsYou fags were posting ai/edited cuckold porn the majority of the time, and when someone pointed out your feats made no sense you basically went back to Kratos tier shitposting like everyone else.
>>153981869The final volume apparently has 12 extra pages of content that the final chapter doesn't have according to the scholars at /a/. It comes out June 2 iirc.
I'm glad that Dabura downscaled everyone in JJK. He was a hero and I thank him for his contribution.
>>153981880>ai/edited cuckold pornSays the JJKfag who literally made that the OP of a thread
DenKING revived the halls
>>153981834>100 x faster than sound Yuji >Dust scaling that got wanked harder than State Swords (no compression calc)>JJKeks are still bitchingYES. MIND BREAK THEM DENJI
>>153980930Everyone who's anyone.
>>153981875Less modelling work needed to be doneLess "retarded unfunny gags that take away from the action"I'd imagine those are the main two reasons
>>153981855Gojo only managed to tank it because of how cursed energy works. If you get hit by your own CE, it won't do as much damage as it would against the opponent. If Sukuna or Mahoraga had fired an attack at the level of Purple while Limitless was down, Gojo would be wrecked pretty badly.
>>153981892Uh...1. Finally admitting compression hax2. Can I see feats of the oregon sword?
>>153981799>He healed at least 27 times while unconscious btwGeting some limbs cut off and likely getting fed blood. That's not comparable to getting his entire body turned into blood mist multiple times in the domain expansion. Denji's supply has ran out for way less. >That's never differentiated from normal poison.Why wouldn't it? Poison is literally a chemical compound. This "poison" in Yuji's blood is magial due to his CE. Denji doesn't have any feats of poison resistance that could logically be transfered to this fight. Drinking devil blood which just tastes icky is not at all comparable. Also it's not. Naoya himself starts vomiting blood. Uraume gets incapacitated by it. Characters in modulo get sick and incapacitated by it. >Ok. Denji tanks it.Denji can't tank for shit.
>>153981884oh shit cool i didnt know that was coming
>>153981806Do they just want Aang to get gaped even harder than he already does or what
>>153981852Why are you telling us that, Denjibro?
>>153981036BASED.
>>153981589They do this every time to prevent 0-3s. These are the same idiots who said base Batman low diffs peak human Captain America, after all.
>>153981885>downscales the entirety of JJK speed>also placed above every other JJK character in power but nobody scales to him>peaces out before Mahoraga fought him through his adaptation, or before his Domain Expansion showed off anything, or before Yuji fought himIt really was a 4v1 huh.
>>153981852kek
>>153981855>Said purple was stronger than Yoru's nuke punch>Gojo could tank an attack that would've turned Denji into a nuggetAlways beyond on Gojo, baby!
>>153981852
>>153981851>Then he reveals he kept a bird in his endless stomach in case he needed blood so I don't think Denjiman would ever actually run out of regen againBut he actually does run out in that fight, his ripcord pull fails and he didn't regenerate. What are we doing here man
>>153981921Gege and Dabura really helped Denji win here.
>>153981174>one femtosecond before Sonic RAPES and GAPES Goku and his entire verse
>the sequel downscales the character and costs him the winWTF that just now happened two times in a row.
So uh.....does Denji actually bypass infinity or UV? I heard the research team believes that pochita can teleport but idk.
>>153981908they want to do Final Elemant Traveler vs Bullshit Universal Spirit World Sword Aang
>>153981939>femtosecondSLOWnic...
I need to rewatch this episode because holy fuck this was brutal Yuji got scaled to his entire verse, and he lost to a DOWNPLAYED Denji...
>caps his verses speed>refuses to let anyone scale to him save for guy with adaptation powers>refuses to show off anything about his domain expansion>proceeds to fuck offDABURATOOOOOOOOOOOOOOOOOOS!
>wtf denCHAD you beat up some random guy and sliced him open?>That's so fucking hot
I wonder if they decide the winner based on the donor's favorite.
>>153981944without modulo i really think denji could kick yuji's ass without needing to transform at all
>DenjiTOS Fuck JJK
>>153981946No.>>153981955I mean they explicitly had Yuji NOT scale to Dabura (who was also put as much stronger than Yuji lmao)
>>153981946He can survive UV by wrecking his own brain, having Pochita tank the damage for him, or just escaping before the barrier is completely closed
>>153981390Blessed be!
Dabura truly is the strongest considering he alone cost Yuji his win.
>>153981946Nope. Best he could do is eat stuff to make life hard for Gojo but combat wise Denji/Pochita is just a fast beat stick.
>>153981970Without Modulo Yuji would be scaled to speed of light.
>>153981969Have we gotten any matches that were pitched? Did the guy pitching it outright say who he was rooting for?
>>153981977>mach 3 kaisenNOOOOOOOOOOOOOOOOO I NEEDED TO LIE AND TELL EVERYONE I WAS FASTER THAN LIGHT SPEED WHYYYYYYY WAS THE AUTHOR BEING REALISTIC FOR ONCE
DENJITOOOOOOOOOOOOOS
>>153981901>getting fed blood.Why the fuck would Public Safety be feeding him blood? They're trying to put him in tiny boxes >Denji's supply Denji's blood supply did not get overtaxed until the last arc btw. He only gets knocked out before this and he was drained of blood after Chainsaw Man Church >It's magical bloodLiterally everything in JJK is based off some science, why the fuck would Yuji's poison blood be the one thing that's just pure magic?>Characters get sick That's it? >Denji can't tank shitSorry, CANON battle said otherwise
>building level moon spear>building level oregon sword>"tanking" the nuclear punch because death literally doesn't existWhat a fraudulent pity win.
No I will not be giving you my scaling.Yes I will be capping your verse.
>>153981977They started rooting for Denji after his preview and are euphoric after Denji finally winning something.
>>153981984maybe by a retard
>>153981900>HaxNotice how that word was never said >Feats?Oh, just watch the episode
>>153981996y-yujisurabros....
>>building level moon spear>>building level oregon sword>>"tanking" the nuclear punch because death literally doesn't exist>What a fraudulent pity win.
>>153981901malding speedy>>153982000Slowreading Scholar
I can't believe Dabura didn't say "I was going 99% the Speed of Light. Also Yuji would beat me"
>>153982009Dabura please! I NEED THIS!!!!
Who will he fight in Death Battle?
>>153982002post yuji blowing up a building without using fradulent scaling
>See some random human miraculously escape from inside a monster's belly>Immediately assume he's evil and start trying to kill the shit out of himIs that really in character for Yuji?
Funny thing is Hulk would defeat those two pedonimes characters with his eyes closed
>>153982009Let Denji have this, anon...He's been through alot.
>>153982026Darth Malgus
>>153981954He had to wait for the exposure or the picture would be ruined.
>>153981946Yes. Denji just eats the curse devil and solos
>the reason why Yuji lost because he fucking FLED from DaburaHonestly the funniest fucking outcome, thank you Death Battle
Denji might have won but reminder he has been cucked out of two of his waifus now, one of them to a MHA character
>>153982002>>"tanking" the nuclear punch because death literally doesn't existretard, Chainsaw man cant die
>>153982031who knows KEKji is barely a character in the first place
>>153982026Nappa
>>153982026Universal Multiversal Tier 1-A Outerversal Pochita (no more holding back) defeats him
>>153982031No. He would be chill about it. A better setup would be Denji coming after yuji because of what happened to makima. Part 1 Denji would do that.
Is sukuna vs hao asakura a thing? I think its neat
Name ONE character who can beat him
Megamind. Yuji. Two winners in a world where sequels don't exist.
>>153982056>Denji coming after yuji because of what happened to makimai dont get it
>just because a character is said to be able to do something doesn't mean he actually canOh my god, my hero is so fucked
>>153982042>Denji might have won, but>COPIUM ACKKK!!!!!?
>>153982042We have still yet to see Denji's main waifu Yoru in a fight thoughever
>>153982063Denjiman (with chainscaling statements[with devils to eat])
>>153982057>Is Sukuna getting brutally gaped a thingA stomp that hard wouldn't even be entertaining.
>>153981977I hate that faggot serenity
>>153982057Hao rapes Sukuna though.
>SuperCHAD walking through Goku's strongest attack >DenCHAD walking through Yuji's strongest attackMy FVARKING HEROES
>>153982063cucky asta
>>153982050Retard Battle thinks Omni-Man is stronger than a Super Saiyan so Thragg would be too strong for Nappa with their scaling.
>>153982063Idk Aquaman probably
>>153982063Bucky
>>153982015How the fuck would you define magically compressing something without physical contact, thousands of mile away not a hax?
>>153982076Idk man maybe they could use pre shaman king hao
>>153981900>compressionThat doesn't make the Oregon Sword weaker. If it still maintains its mass while being compressed, the sword's density would go up to compensate due to the compressed space. If you split mass into a product of density and volume, the force of a swing from the Oregon Sword would be the same regardless of its size. Also, Yoru went through multiple states when fighting Denji.>>153981984But Yuji would lose his AP, and Soul Dismantle would be negated due to the nature of Denji's connection with Pochita.
>>153982086>CANON BATTLE is spreading FACTUAL RESEARCHED FACTSNice!
>>153982057never saw thathao vs yhwach is quite likely though
>>153982089power?for black men
>>153982042>Gojo vs Makima retconned because of new Gun Devil feats >Nobody asked for Bakugo vs Reze or wanted itSimple stuff. Yuji also lost one of his boyfriends to a MHA character
>>153982057>hao asakuraIsn't he like Universe level by the end of the series? How is this even a fight?
I went to take a 5 minute walk after the db episode. I told a girl i was a denjibro and she did THIS to me...
I CONTINUE TO FIGHT
>>153982098I would define it as telekinesis
Seththeprogrammer legit thinks Invincible > JJK in terms of power. He said unironically that Thragg beats Gojo in like 3 different livestreams.
>>153981579Yeah that’s who I was talking about
>>153981152kekarooooo Even Gege hates his retarded fanbase
Is the scary getter in here?
>>153982026King Vegeta
>>153982086But if DragonBall's had two loses in a row, they could disregard all prior scaling which would give Nappa the edge.
>>153982089is she cosplaying as that one girls frontline doll that looks like power?
>>153982129well at least he has a feat unlike Bardock
>>153982050Nappa is gaped by Bulletproof via Death Battle's scaling logic
>>153982110>Gojo vs Makima retconned because of new Gun Devil feats>retconnedYou mean the part in which it's now a projectile? Gojo would stomp even harder given that the only wincon DB gave Makima would no longer be valid
>>153982118Seth is a pedophile who pretended to become a christian.
>>153982132They did say to ignore the results of previous episodes and to consider each episode as a stand alone one (KEK).
>MHA defeated both JJK and CSM without losing a match to eitherYup yup yup My Hero ACHADemia OWNS these halls
>>153982108This but yorozu
>>153982108Do /co/mblrinas really?
>>153982105No? Do you know the result of E9 KG of mass hitting a building right? Or the fact that it can casually stand above buildings, it doesn't have the weight of a country you monkey.
Part 1 Denji vs JJK Yuji: Denji stompsPart 2 Denji vs Modulo Yuji: Denji giga stompsComposite Denji vs Composite Yuji: Denji omegastompsWhat the FUCK?! Why is CSMverse so FVARKING STRONG?!???
>>153982031No.Yuji is actually pretty level headed and chill. He would've helped Denji out of the Devil's guts and check if he was ok. Maybe even treat him to a meal afterwards. DB is just retarded, and don't really know how to sit up a battle with both characters still being in character.
>>153982154Nayuta stomps. My cock.
>>153982143>MHAsissy still bragging about seal clubbingKEKAROOO
>>153982118>Seththeprogrammer legit thinks Invincible > JJKIt does. I don't see why that would be a hot take. The stat differences between Invincible and JJK are bigger than JJK and CSM. JJK gets brought up because it's popular not because it's strong. As far as powerlevels are concerned, JJK has no business being pitted against most of the franchises it's paired with.
>>153982161Yuji after his balls got turned into a dust cloud...
>>153982155Did he get gaped by Russians again?
>>153982140>You mean the part in which it's now a projectileYou keep saying this but continue to not prove it. Curious
>>153982143>CSM was placed at 10x slower than MHA and 10x weaker with far and away its strongest feat in the Oregon Sword (the 300 Gigatons feat was also argued to be with only embers of OfA)Hilariously even Gojo would get fucked by ability negation as the only reprieve from the absurd statgap MHA has over the other two
>>153982161Hal...
>>153982174You could say that...
>>153982174Those Russians solo SHITku
Its too late to bring out the antifeats
>ignoring it's still regenerating some limbs>his regen reached his limit by having most of his torso get destroyed or him getting bisected a few times only>Denji's blood supply did not get overtaxed until the last arc btw.Pochita gets gored a few times each fight and immediately needs blood from a passerby. All of these moments where he reaches his regen limit involved most of his body being damaged. Are we unironically pretending that Denji getting continuously turned into red mist during a DE and being forced to regenerate continuously wouldn't just put him to his limit really fast?>Literally everything in JJK is based off some scienceWhat are you even talking about? CE isn't science. That's why Yuji's blood is poisonous.>That's it?Incapacitated. It shouldn't really heal Denji. That or Yuji could simply use his blood manipulation to erupt his blood like he did against Sukuna. >Sorry, CANON battle said otherwiseIn the fight he literally gets cut multiple times tho? They even admit in the abilitites section Denji would inevitable get cut several times even with the speed advantage
>>153982110>Nobody asked for Bakugo vs Reze or wanted itYou faggots wanted it until you realized how horrific the stomp was in BakuGOS favor
Denji would solo MHA btw.
The only relevant shit i saw in shaman king was hao obliterating the us army how is this a stomp?
>>153982169Doesn't mark routinely get his shit pushed in by guys who are significantly weaker than him? Like normal dude with a raygun weak.
>>153982204Irrefutable
>>153982174Can I take some Russian cock? I'll help you Superman!!
>>153982191Meant for >>153982000accidentally erased the quote fuck
Oh hey. Pee is here>>153981571Part 2 is still a 2/10
I will come back to these halls once denji fags have been thoroughly sterilized by the sentry CHADS.
>>153982176>Bang is a power given by the Gun Devil>the Gun Devil whose attacks are entirely projectile-based
>>153982211Mark gets a big boost near the end of Invincible. At that point, his fights were against Thragg and Allen. He beat both of them.
>>153982204True.
If you want to talk about Gojo vs Makima why don't we compare the high ends for both Jogo's meteor statement and typhoon devil?
>>153982221Wait what the fuck microcuck you're here? Since when? Did the episode bring you over?
Is there any way to make actual matchups for MHA?They're in that weird spot where they get stomped or they do seal clubbing
>>153982191>Pochita gets gored a few times each fight and immediately needs blood from a passerbyHe did not need blood against Makima and almost always fought automatically low afterwards >CE isn't science >Cue to every time they used science to explain abilities Uh huh>Incapitated It's featless in that too. Either way, Denji is resistant >They said he'd get cutOr he speed blitzes and one shots
>>153982252Billy butcher vs staind
who are these people
>>153982252We can get MHA match-ups if we stop using EOS versions of characters.
>>153982252AFO vs Giovanni.
>>153982134yep
>>153982275That would be a stomp considering how wanked pokemon is
>>153982248>Did the episode bring you over?Yep
>>153982252You'd have to use the mid cards of MHA like Stain to go up against similar tier fighters
>>153982246Fuga? Why do you think Jogo was the only city feat
>>153982233>Aging used bang therefore he has a contract with the Gun Devil >Darkness used bang therefore he has a contract with the Gun Devil >Makima used bang before she even fought the Gun devil therefore she must have a contract with the Gun Devil JJKeks can't read
>>153982286MHA has 1 matchup left before it fades away into irrelevancy forever. Does it matter if it's a stomp?
>>153982252A good matchup that isn't just a blatant stomp is something like knuckle duster vs wildcat from DC
https://x.com/i/status/2061151923563344197Say hello to Death Battle's newest recruit
>>153982142I think it was Speedy's take on Raven vs Jean.
>>153982252Iunno, is there some guy at around Teratons level but only the Speed of Light?
>nosotros ganamos?!!Kneel SEAmonkies!!!
>>153982221>>153982248>peeBROS and microcuckCHADS reunited at lastBASED BASED BASED BASED
>>153982290>The episode brought over Pee and MicroKEKAROOO! Man this episode keeps bearing more and more fruits.Try not to upset the scholars here. You'll get your asshole rearranged.
MHA needs to lose horribly for its final episode.
>>153982143>MHAfags getting uppityI think you need a reminder of where you are
>>153982180>Gojo would get fucked by ability negationHe would lose instantly against this chad
I still want Mash to fight Deku
>>153982167>says Supercuck who had to farm and stat pad against the same guy 3 times in a row
>>153982352Mash Kyrielight?
>even reddit is baffled at the absurd wank they gave DenjiLike I said, either way CSM gets slandered. We always win.
>>153982339Time for Yoru to gape AFO with her not low-balled stats!
>redditfrog
If Shart Poo is a 2/10, then what's Modulo's rating?
>>153982363>Reddit>Frog
>>153982363>Reddit was rooting and begging for Yuji to winYup. CSM always wins
>>1539823815 or 6/10
>>153982360No, Mash burnedead.
>>1539823810 lol
>>153982252All-Might vs Korosensei
>Yoru vs AFO>MHA smurfs yet another verselel
>JJKEK
Y'all just didn't get the GENIUS gege and fuji had for their respective series. You were filtered like the common plebs you all are. When CSM/JJK part 3 comes you, you will understand the real intentions of the author.
>DENJI IM SENDING YOU BACK TO GET RAPED BY YAKUZA OJISANSwtf was his problem?
>>153982381-10/10
Yoru turned me into a vibrator after weaponizing me and my entire cucky verse...
Oregon is niggerversal.
>>153982363>CSM lost because redditors like JJK and are buttblasted DenCHAD wonredditfrog checks out
>>153981368This image pretty much killed Frieren.She just dumped all her stats into magic.
>>153982409if there is a part 3 i really hope fujimuto gets into NTR porn by then
>>153982404>They use compression calcs for state swords and highball the moon + star spear >Yoru turns AFO into a cape The end
>>153982388>>153982390>>153982426>copeAlready no one buys the win as legit. It's very funny. Poor CSMkeks eternally buttfucked by FujiBEASTmoto.
>>153982381It's only rated highly because people use it for powerscaling. As a story and epilogue it's utterly dogshit and should be shat on more. The only reason it isn't is because it only ruined Yuji's character so nobody cares and nobody cares about the new protagonists either.
>Yoru>gaping AFOCSM beats JJK once and immediately gets uppity
>>153982428was she trying here?
AFO vs Giovanni should be the final MHA epsiode and it should end with AFO crying like a bitch before getting one-shot by Deoxys.
>>153982437Buddy, you're the one coping about how Denji winning doesn't count because reddit doesnt like it
>>153982190Never too late, Krasura opinion swung overwhelmingly toward Asura thanks to constant posting of antifeats
Sukuna is going to fight Kishin Asura.
>>153982437Didn't read. You're fucking brown and a tourist. Go back to your hellish landscape instead of poisoning these HALLOWED HALLS! The SCHOLARS have always hated your ILK!
>DENJI IM SENDING YOU BACK TO HAVE TONS OF UNPROTECTED SEX WITH POWERWhat a bro
>>153982457>vsbw is calling it dumb>spacebattles is calling it dumb>this place is calling it dumbHow am I coping?
>>153982428All mages are like that though. That's why they fear warriors so much.
>>153982445I don't know the context admittedly, that guy is like a master assassin or something.
>Pokecucks still trying to convince people that their featless fraudverse can beat anyone
>>153982468>>this place is calling it dumbit isn't keeeeeeek
>>153982442>Compression calcing state swords gets into the sextillion tons of TNTI HATE WEAKLING
>>153982468Read your own posts
https://youtu.be/kOn-HdEg6AQ?si=eUNENwRUdQ5EcRA_>I dedicate this to all Yujifags in the thread rn
>MHAcucks crying over their inevitable loss
>>153982381At best a 5/10 since the fight scenes were still pretty good.
>>153982464What exactly was the problem with this ending? Yeah It's sudden but how else should this have ended? The world was being destroyed and all of Denji's friends were either dead or crazy. This was mercy.
You would think Bakureze would have TAUGHT CSM to maybe stop bragging about how they could totally beat MHA. Especially when the fucking stats they gave here vs Deku vs Miles means MHA horrifically statstomps even before any additional boosts or higher feats to calc
At least Yuji beats Gon...
>>153982267>He did not need blood against MakimaWhy are you pretending this is a flex? Worse damage he had in the fight was self inflicted by ripping his own heart out. Then he gets hit with the spear and immediately starts begging Power to bail Denji out cause he is all tuckered out. That's a worse showcase than the part 2 fights and even in the part 2 it's pathetic. he is at his strongest and still getting blood-limited by getting gored a few times. That's not even mentioning you're comparing that and his other fights to him literally being turned into blood mist in the domain expansion. He is not mahoraga, bro. He'd run out not even halfway through the DE. >>Cue to every time they used science to explain abilitiesBait or mental retardation >It's featless in that too.Going back to this? Cope. "Denji is resistant lol" this goes hard in the local playground>Or he speed blitzes and one shotsDE = gg. At least you can be happy your verse isn't 0-3 after Denji got scaled to every character in the verse including muh country-level sword cause Denji and Pochita don't even have building level feats.
>>153982275So you admit that composite cucky Giovanni does not no-diff AFO? Otherwise you little bitch would have no reason to suggest this as a non-seal clubbing matchup.
>>153982495>couldn't pull the trigger like DevilmanFujimoto gave up and just went back to gooning
>>153982390Nah they were pretty much completely team Denji after his preview and G1.
>>153982487>no argumentYou lost
>>153982515Cucky Fox.
Also doesn't AfO have Decay? And because of muh speed boosts he would be faster than every single CSM character
>>153982522>seething so hard xhe started posting xhir cuckold interracial fetish
>Frieren vs Sukuna>Ends with Frieren getting cut in half while she sobs and desperately tries to put her guts back in her body before her life pathetically fades from her eyes >She looks up and thinks she sees Himmel and she smiles>Blinks and it's Sukuna >He slashes her head clean in half, her eyes and brain flop to the ground>KOYUMMY RYONA GIVE IT TO ME NOW
We're getting yoru vs afo aren't we?
>>153982522GOOD MORNING SAAR! TIME TO REEDEEM THE IZZAT FROM YUJI!
>>153982468>spacebattlesReminds me of when JJKautists were so bad at arguing they were unironically posting screenshots from there. Your kind just has a hard time thinking for itself I guess.
>he downloads and saves BLACKED pornYujifags everyone
>>153982529Why tf is this even a matchup? Who tf even wants this? >>153982531
>CSMkeks getting uppity Asa/Yoru are for getting GAPED by Ai Coleman
>AFO's matchup is either Pokemon sealclubbing MHA or MHA sealclubbing CSM>oh and the MP100 matchuplol
>>153982522she did this
>>153982552One single Pokecuck is trying to force this because after getting RAPED and GAPED by Yugi he hopes this will give Pokecucks an easy win (but he still won't post any feats and insists about a composite version of Giovanni's team to be used).
>AFO gets one shot by any of Giovanni's stronger Pokemon >AFO gets turned into a necklace by Yoru because he moved and lost the game of red light green light BRUTAL OUTCOME FOR MHA'S LAST FIGHT
>>153982563Atrocious thumbnail
>>153982572AFO will fight Toichiro
Enough Giovanni vs AFO.What about En vs Giovanni?
>>153982550Spacebattles is one of the few places on the internet where they don't overwank everything. You lost.
>>153982550>You can post analysis and arguments from anywhere except from sites that actually analyze our feats and finds them lacking.
Uh oh
>>153982506>Then he gets hit with the spear and immediately starts begging Power to bail Denji out cause he is all tuckered out. That's a worse showcase than the part 2 fights and even in the part 2 it's pathetic. he is at his strongest and still getting blood-limited by getting gored a few times.Pochita was taking 100 lasting damage that entire time retard. How about you reread the manga cause it very clearly explains he only starts taking damage cause people stopped fearing CSM and viewed him as a hero.
>>153982495>Plot Devil Pochita saves the day with his new attained power of resetting the universe >Shreds the last redeemable part of Denji's character by revealing he was never happy with his family at any point in the story and is at his happiest being miserable, after part 2 being an entire humiliation ritual for him>retcons part 1>Plot Devil Pochita conveniently makes it so that power somehow is the one that saves Denji, Nayuta is still a thing and Asa meets Denji anyway>"Cause you're a man with a chainsaw"
>>153982552Idk why I linked Cucky Fox>>153982571What even is the theme here?
>>153982565The mob psycho 100 matchup is something they lose funnily enough.
>You were kind of strong, weird red and white haired kid>I'll never forget you as long as I live>*bisects Shoto with his MFTL speeds which he totally has*
JJKBROS don't look!!!
>AFO vs Yoru is just Bakugou vs Reze but Bakugou doesn't even have to bother dealing with regen because Decay
>>153982522reze version please!
>>153982468>vsbw is calling it dumbThey're praising the animation but are calling the logic behind Oregon Sword faulty. They mostly agree that Denji is faster.
>please care about cucky Giovanni
King Piccolo will fight yoru. Dragon ball autism vs chainsaw man.
>>153982506>he is at his strongestOperating on zero blood in his two out of three fights in part 2>GoredYoru and Pochita were fighting for hours >The spear He was knocked out. His regeneration wasn't overtaxed >BLOOD MISTpost Yuji ever doing this>No argument Denji rapes your verse
>>153982599Why are people acting like an entire state getting compressed into one weapon wouldn't be powerful?
>>153982606So if MHAbros are smart they'll goad CSM into another BakuReze situation with Yoru vs AFO
>>153982638King Piccolo is for AFO.
>>153982590>>153982596Keep the tears coming
Its prime time baby
>2 threads up with 800+ replies eachTHE CHADS OF /CO/!
>cucky Giovanni's team is totally continental>just don't ask me to post them actually destroying anything let alone a continent
>>153982522canon
>>153982661Denji DIMES.
>>153980476Nice match up, you wanker.
>MHAsissies are literally pushing another pity win matchup because they lose their other matchupsFunny and sad.
>>153982657Isnt piccolo daimao city level?
>>153982660Prime time to losing to Sentry!
>>153981782I'm that guy who made the image AMA
>>153982659Denji's so goated
>Pokesissies are literally pushing another pity win matchup because they lose their other matchups>they probably lose the matchup that they are forcing tooFunny and sad.
>>153982631>The CSM downplay sites are seething because CSM wasn't downplayed Was the seethe this bad when they claimed Gojo can regenerate from mind control and scaled Jogo's building level meteor higher than Typhoon Devil's city level storm?
>haha yes Yoru would totally win against AFO you should spam it on twitter and post fanart of it and push for a DB of it
>>153982659>when tyrone lets you finish inside of powey
So all those feminization fantasies from Yujikeks were for nothing?
>>153982640Because that would mean CSM rapes their favorite nushonen verse
Don't let that distract you from the fact that Pokecucks tried to pick a fight with Fairy Tail and instantly got BTFO and ran away in the last thread.
I'm going to Ronnie McNutt myself this is soft fucking embarrassing.JJKbro btw
>>153982697>but DB put Denji at 10x weaker and slower than Deku? Haha come on that was just downplaying they had to make it close you know you'll totally have equal stats (don't worry about decay)
>>153982680Moon level or planet level.
>>153982640its called copeand this >>153982701 is seething
>HARMONIZES the composite Chainsaw Man verse by erasing devils from existence
>>153982640Because it can't even destroy a city block.
>>153982726Holy fuck...I want that Chainsaw DICK inside of me...
>>153982730Post Goku blowing up a planet
>>153982515Sonic fears this btw
Yuji was killed by a guy with one nut
>CSM gets one Kratos tier pity win (that no one agrees with) and immediately start barking at big dawg MHAI guess it's time for another raping. These little cucks never learn.
>>153982727Wouldn't that be a literal improvement over how fucked the CSM world is?You know I don't know why Gege did Modulo over writing about what went down in Kashimo/Ryu's time or whatever
>>153982730I'm pretty sure Oregon has a couple of cities in it.
>swan puts silver chariot at 1500x ftl even though polnareff explicitly stated that light speed movement was beyond his stand's capabilities >JJK has a similar statement >This time it's actually listened toOpen bias on display kek.
>>153982681>This faggot thinks that kektry has a chanceSo lame
>MHAsissy trying to push for a matchup that has zero connections because they want another pity winMHAfags are like blacks. They demand reparations because Deku got GAPED by Asta and they can't let it go.
>>153982744>MHA just sees a big fat exit ticket from having to fight character with Deoxys that everyone knows DB will put at thousands of times FTL/planetary
>>153982727Takaba on steroids. His power is reality warping with zero draw backs.
>>153982763You're telling me Prime (who is stornger than Superman) loses to a canon cuck!?
>>153982693they beat the Pilaf Gang
>>153982600>Pochita was taking 100 lasting damage that entire time retard>Pochita simultaneously beat all the hybrids easily to the point Makima starts shitting herself, but also he was taking 100 minecraft void damage the entire time and at deaths door regenerating the entire time. Lmao. Ridiculous cope. >>153982639>Operating on zero blood in his two out of three fights in part 2If that was the case, how was he regenerating? If he doesn't need blood for regeneration why does he ask for blood once he can't regenerate anymore? Retarded cope. >Yoru and Pochita were fighting for hoursKek. So now each panel is 1 hour passed, except for the moon spear that was 0.0001 seconds. >He was knocked out. His regeneration wasn't overtaxedHe had to go beg power to help Denji and Power sacrifices herself to save him. Sure, he was just taking a nap real quick and was totally going to BTFO Makima if he was allowed 5 more minutes. >post Yuji ever doing thisPost Denji destroying a building>Denji rapes your verseMy favorite verse isn't even JJK, I'm just saying the result is retarded and contradicts the previous battles. If they were consistent then Gojo should've lost too cause he wouldn't be scaled to anyone but himself and Makima scales to everyone in the verse. Though to be fair that's the usual deal.
>>153982724Did they retcon piccolo's power? I remember that his best attack was city level
>>153982622Afo doesn't even have decay unless he's in Shigiraki's body
>>153982759That Silver Chariot feat? VSBW recalced it to be 25000x FTL btw.
How do I stop women from harassing me publicly? I'm a denjibro if that matters
>>153982640Because when being swung it barely destoys buildings
>>153982781Nope.https://vsbattles.fandom.com/wiki/King_Piccolo
>>153982777Idk what "stornger" is but prime decimates sentry
>>153982730>this instantly kills the argumentBut AP is not DC cope o algo
>>153982792no one talks to you period
>>153982781Country level actually via statements but people are trying to scale him above Roshi's moon bust
>>153980734>Yoru literally states at the beginning of the manga that the strength of the weapon depends on the user's emotional attachment to itNope. It's both the actual thing + guilt boosts. Asa felt no guilt over buying the prisons weapon systems and they still acted like the weapon system. If anything, you're arguing that State Swords are above country level because of the guilt boost Yoru would have for destroying an American state
>>153982772>Yoru GAPES AfO!>Then you should totally push for this fight btw>Y-you just want a pity win!I see they learned from last time
At the end of the day, Dragon Ball had the cooler Dabura.
>>153982789Swan one time calculated it to be a million times ftl on his personal blog (using very admittedly high end assumptions). Sadly the calc has been lost to time . If only gege made yuji a reincarnation of DIO.
>>153982793You want to argue a state is weaker than a building?
>>153982730>>153982730So Goku's ki blasts are sub Oregon?
>>153982780>If they were consistent then Gojo should've lost too cause he wouldn't be scaled to anyone but himself and Makima scales to everyone in the verseThat was before Dabura capped JJK's speed.
>>153982772>a matchup that has zero connections because they want another pity win>cucky Giovanni vs AFO and cucky Blue vs Bakugo out of nowhere
>>153982804Women literally flirt with me nearly every time I leave my house
>>153982823thats why you come onto here to larp
>Wow can we see Jojo perform another single relativistic or FTL feat besides Silver Chariot and the MiH no one else scales to>...
>the MHAcuck is hiding from GiovanniKEK.
>>153982799>Doesn't explain why >H-He just does okay!!DCkeks...it's okay for your verse to keepp getting gaped.
>>153982806Yeah i remember that piccolo killed shenron that makes him moon level i guess
>b-b-buh reddit sai-No one cares.
>>153982822>MHAcuck admits his verse is weak and cowardlyYep.
>>153982370To be fair, CSMbros did ask for Yoru vs AFO first lel
>>153982743Yuji didn’t have any nuts left after the fight anyway
>>153982841Post sentry destroying a planet or a universe
>JOBura
>>153982820>That was before Dabura capped JJK's speed.That doesn't matter cause Gojo lost in speed anyway, did he not?
>Yoru gets gaped by AFO>Power gets gaped by Foo Fighters>Aki gets gaped by Potential Man>All the primal devils get gaped by literally any of their match upsMan, this really was a pity win, huh? Damn...
>>153982832Star platinum and the world
>STOP SEALCLUBBING AND LET ME SEALCLUB YOU INSTEAD!
>>153982780>how was he regenerating?He wasn't. Until Denji drank tree blood and Aging tried to stuff himself in his mouth. Read the manga>Yoru says their battle feels endless >A state sword gets off screened >"It was actually like 5 minutes"What a tard>Getting knocked out is taking a napWhat a tard>Denji destroying a building Chapter 5 Denji shit. Post Yuji doing that
>>153982867Post SuperFAG Prime destroying anything
Why doesn't Death Battle do Street Fighter matchups anymore?
>please talk about mha
>>153982738
>>153982875the seethe is palpable
>>153982894because they're all jobbers including her
>>153982894hi
>>153982887 I asked first faggot
>They should totally do Yoru vs AFO!>Why not a fair matchup?>Um...well...
>>153982856>says the Pokecuck after trying for months to force a matchup that no one wants in the hopes of getting a pity win after getting RAPED and GAPED by Yugi
>CSMfags won>Somehow they're throwing a huge temper tantrum???
>>153982814>At the end of the day, Dragon Ball had the cooler Dabura.The bitch that got eaten in 3 minutes?
>>153982895But I already do this every single day. Pokesissy btw.
>>153982917>dodging the questionGuess he can't do shit. Can't wait to see DKEks get gaped again!
>>153982887
>>153982929It isnt CSMfags making AI slop of interracial cuck porn though...........
>>153982929They know yuji should have won kek.
>>153982816The sword itself simply never outputs anything on the level of conversion of the state. Otherwise it should at least be able to do considerable damage to the city they're fighting in rather than just making cuts in buildings.
>getting merked by something but recovering means you scale to itHoly FUARK... Mr. Satan is now Buu level, guys!
>>153982902Goku himself, spic. This multiple person feat only destroyed a single planet.
>>153982875none of those matchups will ever happennext csm episode will be a makima return and that's it for the series
>>153982875>Compression calced Yoru flattens MHA >Power just suffocates Foo Fighters >Aki literally just stabs Megumi >Falling Devil immediately rapes Yuji>I don't know any Darkness, Aging or Death matchups Seethe
>>153982945lemme see that
>>153982923>fair matchup>Deoxys is planetary and massively FTLIs it really though? Isn't this just you wanting a pity win over a verse trying to get its own pity win?
>>153982927Ben and Chad want to do the matchup. Cope and seethe :)
If it wasn't for the heavy power imbalance and him being dimeless now, Sylar would've been the perfect matchup for AfO
>>153982964>>153982522
>>153982961>Compression calced Yoru flattens MHAYou should campaign and push for Yoru vs AFO.
>Pokecuck seething at literally any other infinitely more dimes MHA matchup being discussedKek.
>>153982961>>Compression calced Yoru flattens MHAYou think country level is impressive by MHA standards? Lmao.>Thinks power is beating jojo wank>thinks Aki can do shit against Mahoraga>for some reason mentions Falling Devil vs YujiCSM won, yet they're still butthurt...
>>153982522Denji? Likes to watch
PLEASE PLEASE PLEASEEEEEEEEE LET ME FIGHT MHA. GIVE ME MY HIGHEST WANKED COMPOSITE TEAM TOO. I NEED A PITY WIN PLEASE. DEOXYS TOTALLY RAPES AND GAOES THEM EVEN THOUGH HE IS A FEATLESS BITCH RIGHT?
Pokemon already has a pity w for pucci vs cyrus. Why do we need to bully the MHA verse for one?
>>153982961>they capped CSM at relativistic at the high endEven with state sword wank Yoru just gets instantly blitzed by AFO who'd be FTL
I'm playing the FFVII Rebirth demo on my Switch 2. Liking it so far. How strong are the FFVII characters?
>>153982980lemme see more
What the fuck?
>>153982894They could've if Juri won Champion Island
>>153983014Why would AfO be FTL?
Someone explain why Pokecucks constantly accuse MHA of being frauds who resort to seal clubbing, but then brag about how Giovanni will neg-diff the league of villains (without providing any feats that support this braindead narrative) and proudly force a matchup that in their eyes is also seal clubbing?
Thread soundtrack https://www.youtube.com/watch?v=on-uzrjl7-c
>12 mentions of "Poke" in this threadgee talk about obsession
>>153982986>He thinks they'd let MHA win three matches in a rowThey'd unleash un lowballed Yoru to rape everybody. But I got cucked out of Blue vs Bakugo because Death Battle had to use a main rival against a one off part 1 CSM villain to give them a pity winAFO getting raped by Giovanni or Yoru are both fine by me
>Pokemon vs MHA>no one suggesting Denki vs Pichu as a joke matchYou faggots can't book for shit
>>153983041Shigaraki laser catching
>>153983014>Quite literally said they low-balled the fuck out of Denji on purpose and that he still winsJJKeks...
WHAT ABOUT BORUTO?only newgen series not to get an episode
>Denji finally gets his big win>Just three hours later everyone has already moved on to Pokémon and MHATruly CSM isn't even remotely relevant.
I scale to Oregon.
>>153983071That's not more impressive than star spear intercepting or Gun+ Tank Devil weaponization speed
>haha no I-i'm okay with Giovanni beating AFOAre you sure? You know MHAfags were absolutely putting you through the ringer calling your verse weak right? I think, you should ask for Yoru vs AFO and TEACH them CSM is not to be trifled with
MHAMHAMHAMHAMHAMHAMHAFIGHTMEINEEDAPITYWINMHAMHAMHAMHAMHAMHAMHAMHAMHAMHAMHAMHAMHAYUGIRAPEDUSMHAMHAMHAMHAMHAMHAMHAMHAMHAMHAMHA
The winner? SONIC THE HEDGEHOG!BOOM!DONE!
>>153983055Zetton
>>153983059As if Makima isn't THE AFO CSM opponent?
>>153982026The Plutonian
Reminder that Giovanni doesn't even get Deoxys permanently, it was a temporary team member.
>>153983086>DB admits to low-balling Denji and he still rapes the entirety of JJK>Yuji was so raped that CHAINSAW CHADS move onto to different universes LMAO
>>153983100*wringer
>No you see my side is having a internet wide meltdown across multiple platforms >That means I won!Why are JJKeks like this?
THE THREAD WINNER IS FULGORE
>>153983100>When Death Battle already admitted Falling Devil solos MHA and rescinded their JJK black hole scaling wank Tragic
Both Ben and Chad love the idea of AFO vs Giovanni, so it's happening. The MHAsissy meltdown is coming.
I have found Yoru's opponent. (He is apparently legitimately small planet level because he scales to the extinction of the dinosaurs or some shit).
>"So did you win the Danmaku fight against Yuji?">"Yeah, I just spammed continues, lmao">"That's the spirit!"
https://deathbattle.fandom.com/wiki/Deku_VS_Asta>Deku was put at 80 fucking TeratonsOh right I forgot lol, so AfO would be at least 2000x stronger than Yoru
https://vocaroo.com/18HeK8ciCzHR
>>153983166Pickle genuinely tanked the impact of the meteor so not that far off
>>153983116As expected. As ALWAYS.
>>153983166Sorry, Yujiro will be in the first episode of RAPE Battle where he will fight against Homelander.
>>153982297Why would Gojo scale to an attack he never faced coming from an opponent that's superior to him?The only thing Gojo has that can rival Typhoon is the mountain busting statement from the gachaGojo is legit a statement merchant and he NEEDS Statements and rigged research (giving him Highballed Statements while lowballing Makima's own scaling) to win
Does anyone have the receding chin Denji pic?I found that shit funny, but the thread got nuked
>>153983125Cucky Deoxys is featless anyways so it doesn't matter if cucky Giovanni gets him.
Can we reach the 1000?
>>153983131*CSMfags
>>153981314Joker v Giorno?
>>153983181>Still no sextillion tons of TNT Still fodder to compression calced Yoru or a Yoru scaled above Falling Devil, which they did for Lobo
>This Quirk allows All For One to unleash a powerful beam of light. It is strong enough to severely damage Dark Shadow in its Light of Baldur form and kill Gigantomachia with a single shot.>look up Gigantomachia stats>27 TeratonsFascinating
>MHA vs PokémonSlop vs. Slop...
Claw vs The league of villains is still a great matchup where shigiraki's decay isn't an instant win and where twice's clones can actally be negged really easily.
>>153983264whats falling devil's best feat
is Lucy still the most powerful horny girl
>MHA vs PokemonIFIGHTTO BE THE WEAKEST ALIVE
>>153983301Reversing the Earth's gravity by just appearing which nearly destroyed the planet
>one of the quirks AfO had but gave away was a quirk that gave 12x speedInteresting.
>>153982882>Read the mangaDid he regenerate in his fight with Yoru, where he was at his strongest? Yes or no? How many times did he get gored in the manga? Let's check: >Chapter 215 Gets damaged by several bangs and his guts fly out. Regens.>chapter 216 Gets reduced to a 1/3 of his body and body gets cut in multiple placesregens the first injury, doesn't the second. >chapter 217Right here he gets blood. So he already was at his limit. >Chapter 219Gets a hole in his chest and regens>chapter 221 Oregon Sword cuts him in half. Amped slash shreds him regens both times >chapter 222 Nuke punch ends him. Gets blood from a passerby and turns into Denjiman. So let's do a count here: His body gets gored 3 times, then he reaches his limit. Truthfully, the damaged of getting 2/3 of his body ripped apart already made him reach his limit since he couldn't regen the next attack since he had to get blood afterwards and pull his cord. Then he once again, with death dead, gets gored single digit amount of times before he loses, and even when Denjiman comes out he needed to get blood. Fuck you. >>Yoru says their battle feels endlessShe literally asked what CSM ate cause he ate death and CSM wasn't dying no matter what she did. For sure she was making a claim that they were fighting for days though! They fought off-screen each chapter transition! Retarded ass cope. >>Getting knocked out is taking a nap>What a tard>Asking another devil to kill itself so your buddy whom you share an existence with doesn't die means Pochita was just knocked out real quick cuz he was tiredCope harder. >Chapter 5 Denji shit.Not even Pochita could destroy a building. Let alone Denji. Cope harder.
>>153983264You should push for MHA vs Yoru then. Since they put Deku at thousands of times stronger and more than 10x fasterYou don't want your verse to be considered a Deku victim do you?
>>153983373Nah, Afo is for Toichiro to utterly rape.
>I would win...>but also please let this other verse have this matchup haha
We all know MHA is going to lose its final match. The question is to who?
>>153983429Toga vs Power to give CSM a pity win without pulling a KINGtos
>compression HAXThis shit would legitimately make Yoru star level if they really wanted to push it, but I suspect they will completely ignore it for the next csm episode suspiciously enough. Like, they will cap yoru at city level and just mention it in a black box.
>>153983429If you ignore AFO most popular character they have left is Toga so pick someone with a copy power to gape her
>>153983122Based as fuck, about time image comics gets raped
>>153983464>star level buildingsholy FUARK
>>153983367>Proceeds to list the only fight where he had a blood supplyInteresting >Chainsaw Man eating death Did not make his regeneration stronger>THEY TOTALLY DIDN'T FIGHT OFF SCREEN They literally showed that Pochita and Yoru were still fighting while Asa and Denji were hanging out in Denji's inner world for two to three chapters. Then Michigan Sword gets off screened by Pochita. Are you a retard?>Being knocked unconscious is the equivalent to getting his Regen out taxedRetard>Not even Pochita can destroy a buildinglol
>>153983456Toga's power is just hard countered by Power. She would just stab her internally with her blood and Toga can't even tank that shit.
Blacked Clover will never get another match.
>>15398346432 Gigatons is actually really fucking weak so I doubt they'll nerf it
>>153983429It would be funny if this happened and Endeavor pulled a Homelander, begging Omni-Man not to kill him, only for Nolan to kill him anyways.
Can we reach the 1k?
>>153983464>Made Lobo compressing a city star levelThey gave JJK large city level scaling because of a building level meteor and also made dust scaling be stronger than anything else in the verseCompression calcing Yoru also fits perfectly with the Pochita eating a star statement so they'll buy it
>>153983550That would be super out of character so I can see them doing it
>>153982586All these pokemon matchups, what's stopping the opponent from separating the trainer's head from their bodies
>>153983560We did it anon
Every time death battle releases a new episode reminds me why i hate the latinamerican fandom
