Previous: >>587305068>Character Trailer - "Mitya: Everything's in Order"https://youtu.be/9OHKzmmq2e8 (EN)https://youtu.be/1Zff-uJ1sz4 (JP)>Character Trailer - "Valeriy: Order in Practice"https://youtu.be/vtOodOYxzp0 (EN)https://youtu.be/NK2K2-H-ww4 (JP)>Character Teaser - "Mitya: Just a Little Trick"https://youtu.be/iaE0CelptSc (EN)https://youtu.be/IAAbvGlvOTw (JP)>Version 7.2 "Hour of Ruin" Trailerhttps://youtu.be/6gFCnMLSw-Y (EN)https://youtu.be/7FEl4aRKtOE (EN)>Current character banner: Mitya, Furina, Valeriy, Charlotte, Rosaria>Current weapon banner: Starsealed Edict (Catalyst), Splendor of Tranquil Waters (Sword)https://www.hoyolab.com/article/47284168>Daily check-in rewards (permanent)https://webstatic-sea.mihoyo.com/ys/event/signin-sea/index.html?act_id=e202102251931481&lang=en-us>Redeemable Codes with Primogems (all regions): https://genshin.mihoyo.com/en/gift6LS3F3LS5K87PJ2KEBRAYSRMY6JYMKV6JKSL>Useful Links (Wiki, Builds, Stygian Clears, Damage Calculators, Wish Trackers, /gig/ friendlist, Third-Party Tools, etc.)https://rentry.org/giglinks/gig/ OP pastebin (use this if making new thread):https://pastebin.com/ca0zseQ9
Never stop Taowing.
Sex with Succubuzuki Sexzuki
>>587349637Tranny
I skipped Mitya and I am going all in Danica btw
>>587349683Having sex with Hu Tao is pretty gay in all honesty, she has the body of a teenage boy.
This is how you're supposed to play the gun mode btwhttps://x.com/1167tomatoOwo/status/2119377352253915380
Varka WON!
>>587349637Our lady Focalors is so pretty
>>587349637Furina looks older in that pic
>t-traveler... i, i can't go on... please defend snezhnaya from these wild boars, they're too strong...
>>587349637Furina my beloved
Who won
>>587349637Sex with Focalors
>>587349812That's her 1500 year-old self
>>587349796...Lohen's heart!
MIDya: I fucking FLOPPED and I GODDAMN SLOPPED!
Sandrone's leaderboard is too goddamn competitive
VarkaBRAHMINS how are we farming izzat this time
Post your looms
Looks like censored flop characaters like Mizuki and Noelle flopped bigly
Mitya: I got WHO pregnant?! *gulp*
Sandy Bina love~
>>587349957Valeriy: *holds up pregnancy test while blushing*
>>587349637Good thread
>>587349991Aether*, cuckfag
Wtf was her problem?
Pit slut
>>587350075young, dumb, and full of cum
>>587349991Valeriy would make a good papa bear
>>587350075she grew up in russia
I had a dream that I was Monsieur Neuvillette. I walked around showing off my long hair and looking down on other less fortunate gacha characters.
>>587350091That's my brother
>>587349804Varka characterization in a nutshell:>what I expectedstatue hand>what I gotcovered walkway
>>587350019I do love Furina and her otherself/mommy
Despite all the literal world ending thing, it really doesn't feel like anything will happen. How can HOYO raise the stakes in a credible way?
>>587350075I haven't seen most of the quest but it's obvious she's being a manipulator when she only tries to steal from you after conveniently overhearing the guy say he's a detective.
>>587349991woke2 has gone too far
>>587349772Only if your brain can pick up the diff, do you want me to highlight it?
>>587350151I want to have sex with your brother
>>587350137Hey dr*gonboi, it's buck breaking time
Look here, listen...The current harbingers Eftirvit, Peruere, Mirko, (hat guy), Feofan, [empty chair], Ajax, [Columbina, an outsider]The current archonsAnastasya, Venti, Nahida, Ei (didn't exist officially), Morax, [Furina], Mavuika, [Traveler, an outsider]
Lukewarm take all the gun mode areas should have been alternative areas entered through those shadow realm portals and if you didn't enter the shadow realm portal it should have been completely explorable in normal gameplay at the very least after beating the area in gun mode for the first time.
>miss vesna...>"ahahahaha lemon lemon, danica lemon, cant catch me, im going to ride a train lalalalalallalala~">there's a vol->"where?"
>>587350279Elves look so creepy
>>587350210Cute boys
It's rather annoying how Focalors rides on Furina's popularity. I'm sure the intellectual powerhouses of /gig/ will agree with this take :)
>>587350161Stop dindu disneyfying every bannerslop character with the slightest bit of conflict and start killing people when shit happens. Will never happen doe
>>587350250>MoraxRetired. Liyue has a new ruler.
>>587350210People used to ship these two back when tigers are still smoking cigarettes
SorryI just came here to prayNow i must bid you adieu
Eradicate all Volkodlaks.
>>587350353People last thread were calling Furina x Hu Tao a forced meme. I'm sure you would agree that this isn't the case here since they're actually linked in the story, unless you're so mad that you've thrown logic out the window
>>587350370Liyue and Mondstadt are the only nations with human leaders
#NotAllVolkodlaks
Uh oh the focalorskek didnt like being called out
>>587350161Hoyo dropped the ball like Bungie did with Destiny 2, they waited way too long to reveal the big bad and even when they're right in front of us we either don't interact with them from a gameplay perspective, or straight up nothing happens. If you look up Bungie's old GDC presentation on live service, it's apparent Hoyo follows the same flawed "train station" logic, albeit slightly more successfully because they don't have a CEO using cash as toilet paper.
https://poal.me/t5kpa1https://poal.me/t5kpa1https://poal.me/t5kpa1
I prefer using the assault rifle, but the pyro shotgun is so much stronger.Is the last weapon in 3 patches going to be the sniper rifle?
Crazy how poorly Furina aged
my favorite genshin porn1. mona struggling to pay off rent and had to suck some old men for money2. jean got kidnapped by mitachurl3. nilou got drugged by some random guy from sumeru4. shenhe having an intercourse sex with chongyun in sauna alongside xingqiu and ningguang5. kokomi got raped by a random guy while she's sleeping at her tent6. raiden chose to fuck mitachurl while leaving aether in the ground 7. mualani got doggystyled by bennett8. nefer got invited into having a threesome sex with varka and lauma9. nicole got dragged by varka to join the orgy party and she had to fuck kaeya in disgust while varka fucking the other girls before varka finally fucked nicole10. keqing letting her multiple coworkers to use her body for pleasure so they can finish the work much faster and more efficient
Today is my birthday!
>hutard still mad over being told to stop riding on Furina's coattailsTragic
>>587350630happy birthday
>>587350630You are a tranny too
>>587350605Keka would do that
>>587350279>There could be viggers here
>>587350605Pretty decent taste
>>587350210GOATed pair for years
>>587350605Good taste
>>587350307Slander hand/fingerBowling pin-shapedbigger thigh
>>587349761T-That's a big girl...
>>587350685...
>>587349761I rolled Mitya and now I want Danica
Chongyun canonically wants to choke out Hu Tao because she infuriates him btw, but this was written out as they tried to make Hu Tao less of a relentless prankster and more of a quirky chungus so she would fit with the Liyue trio
>>587350664Thanks >>587350675...Thanks
cant believe im laughing like a retard over that stupid deep fried vesna face post up there
>>587350460>forced
>>587350727EVAC THE PREMISES, THEN SHOOT THAT VIGGER DEAD
>>587350824Chongyu just wants alone time with Xq
>>587350824Is Chongyun ever going to resolve his arc like Noelle? He's the most powerful exorcist to ever live and nothing's done with it ever.
>>587350824>About Hu Tao>The Wangsheng Funeral Parlor is a reputable institution that acts with integrity. But whenever I see that cheeky smile that says, "It's nothing you exorcists need to worry about," it just makes my blood boil... Whoa, deep breaths, Chongyun. Stay calm.Kek
>>587350630Happy birthday!
>Chongyun: I want to rape and murder Shit TaoWhy'd he say that
Vesna's racism (justified) is what makes her /gig/core
>>587349791where do I get the geo marksman rifle
>>587351130>Redditna>/gig/ coreNo one likes your forced meme character
It's been enough time. Regret metrics:https://poal.me/o8jezehttps://poal.me/o8jezehttps://poal.me/o8jeze
>>587351219but enough about hutroon
>>587351065Ty
>>587351130I bet Volkodlaks were just ordinary people until Vesna came into power and started putting them into camps. Probably why the country's gas bill was in such a state when Traveler arrived.
>>587351270I was going to roll him but C0 looks genuinely terrible and I don't like him enough to go in on cons
>>587350630Happy cake day I wish you many lemons hehehe
Why did /gig/ die all of a sudden?
>>587351219Vodya is the reddit girl actually
Sex with Furina
>>587351645LolTy
>>587350605>Croove - Kokomi Yae Challenge>Akt - Lumine x Cyno>Nagoonination - Mona x Hilichurls>xKazz - Amber Eula>VicLodn - Mavuika Fiery Sex>Akt - Kuki Shinobu >PastaPaprika - Charlotte Service>MastaPov - Mavuika>Jabobco - Hilichurl Fun Time>Vicineko - Hu Tao x Slime
>>587351789Furina is so lucky I wish Focalors was my mommy
>>587350585It's funny that literally no one likes the sex-crazed ice women even in the gooner capital of the Genshin fandom
Do NOT open
>>587351875
35 days.
>>587349637Wifeina!
>>587351920based
>>587351906Oops sorry, did I SOUR your mood with that one~
post organic furina pairings
Did you know that 14% of the Snezhnayan population commit 50% of the crimes?
lemon
Is Danica a must pull if I don't have Yae?
Frotlas is larping as Furina today to push xis usual agendas?
I'm like yeah, she's fineWonder when she'll be mine She walk past, I press rewindTo see that ass one more time
Is Mustpull a must pull for the Musthave team?
I didn't build a lunar charged team and I will not build a stellar conduct team
But who is the mustsex character
>>587352003
Can someone tell Da Wei that nobody cares about the rest of 7.2 and he safely skip to 7.3 now? Please I need the Tsaritsa and Danica right now.
>>587352175Everyone is all in on the upcoming GEOcoin 100x
>>587352283We're all so checked out of Geo as an element that we convert all ranks of Geo gems into other elements first when we need something.
>>587352280No I think he should extend Mitya's banner another 42 days story be damned
Is it true they nerfed Anastasya and she's useless now
>>587349637I love Focalors!
>>587352053I know for a fact that the Furina and Neuvillette posters are from /poeg/.
Betrayed and Trapped Cryo Archon
Stop it Odette... Why are you looking at me like that...
Yeah they doubled Anastasya's breast size and now they're so big she can't move.
>>587350630Happy Birthday!
I'm 95% sure the liyue buffs will be a huge disappointment
Geo: The most boring and forgettable element
Now that I've had Columbina for almost a full year the only criticism I have of her kit is that I think her special lunar bloom charged attack should have had a charge system based on the lunar reaction feeding it charges and the charged attack itself should have had lunar charged and lunar crystalize variants alongside the lunar bloom version she has.
I know Ronova is not dead because benny is still unlucky
>>587352603Thanks
>>587352604It will be the end of Genshin if it's true; Genshin can't afford other china hate
I asked GPT to recreate Rhinedottir as a human.
>archon's signature artifact set gives a fuckton of CChance and a bit of ATKfucking why? she's a cryo and will have cryo team resonance and her ascention stat is fucking CChance
>>587352414sexiest girl
>>587352805never post again
Never Stop Rinding
They leaked Phanes.
>>587352816We all thought she would give super crit but lol.
>>587352805More
>>587352926
GODierro splattered your twisted harlot's guts all over the snow with the full force of the living and everybody cheered
Ronova was pathetically weak given what she is. Rerir was a much stronger foe.
>>587353146In her defense she wasn't trying to harm or kill anyone prior to her authority being taken away. The rules prohibited her doing so. And by the time she had the authority of death taken away and was no longer held back by the rules Pierro was there with his new eye of the Fatui and her fate was basically sealed as he had the authority of death and she did not.
What artifact set does Cheld use?
>>587353316Lol
>>587353316bro is tier 6
I don't think I've ever willingly used a Geo character except for Noelle right at the start of the game when she was given to me practically for free.
>>587353316The Fatui exclusive artifact set 5 years from now.
>>587353316Noblesse Oblige 4pc
Archons love me.
>>587353316Nymph
>>587353316I think Heart of Depth or Nymph's Dream were contenders
>>587353146>Naberius under Rhinedottir's control>Istaroth casually in cahoots with chaotic neutral witches>Asmoday joining the Abyss sibling and their Order of ex-Khaenri'ah's Ronova was just a retard who failed to get the memo
>>587353146This light realm energy slash from traveler would fuck Rerir up
>shartemis is so mind broken he's copying taowing now
HOLY FUCK VALERIY RUNS LIKE A TRUCK
>>587353316nymph's dream is the best for him over all, but by the time it came out most people stopped caring about him and never upgraded from HoD which makes his recommended set usage statistics misleading.
>>587353146They had to nerf her so Pierro would stand a chance with his slightly upgraded delusionGenshin story is a checklist and Ronova had to die in that version, even if it meant jumping the shark
>>587353568Enjou will speedmog him, trust the plan
>>587353560weren't you making fun of binaschizo when he complained about you copying oniglan, shartlies?
god I hope pierro dies a humiliating death soon
>>587353636>slightly upgradedit was an entire (abyssal) moon worth of authority
Playable character built like this when
>azhdaha STILL not playable in 2020+6
>>587353798right after rooster
>>587353146There is no established in-game lore beforehand that would point to her dying easily like that. They just had force her death because muh good vs. evil.
>>587353702wasn't shartemis making fun of ghillies just the other day for mocking xim with variations of xis own posts?
>>587353020HotGenshin needs Live action movie
Any leaks of Danica/Anatasya animations yet?
>>587353828I'm half expecting sovereign quests once we finish the archon quests, and the sovereign's minus Neuvillette will be the new archon banner equivalents in the post archon banners world.
>>587353918They've been out for like 10 days
>>587353918Danica uses a giant anchor because she has severe theming schizophreniaTsaritsa's anims are boring like Tsaritsa and her design.
>>587353918Go to Youtube and search for " Anastasya & Danica beta "
>troonlies is talking about himself in the third person again
>>587353918Yes. They're both all over the place.
>>587353963I've been away from /gig/ and all media for like 10 days to avoid spoilers
>>587353918Do you live under a rock by any chance?
>>587354070>>587353828DUMB FAT FROG DIE AND PASS ON THE SOVEREIGN TITLE TO A WORTHY RECIPIENT
Why is there a teleporter to just leave empty-handed behind the tree in domains? Has it always been there? What's the purpose, you've always been able to teleport out to the domain entrance with a quick map press.
>>587354159>UID 63-Yes since 1.0
i hate shartmon so much bros
>>587353316NOT heart of depth, a huge amount of his damage comes from his forward vaped burst. Everything else does jack shit in comparison.
>>587354159If I remember right you used to rerun the domain through it or you had to exit and re-enter the domain to run it again or something like that.
Everyone loves Paimon.
>>587354159The Irminsul (lol lmao guess they still exist in domains) trees that you re-vitalize with resin used to physically spawn artifacts that you had to press F to pick up. After you picked them up, you would have to leave manually. They got rid of that because a Venti player in co-op could troll you by sucking the artifacts off the ledge.
>>587354159>UID
Ngl if i was Noelle, after six years of proving my skill, saving people, and getting rejected over and over again to work on my dream job and suddenly the company/organization offer me that job, i'd probably walk out in an instant lol, probably get super pissed on top of that because at some point, if you spent years chasing your dream and failed on doing that, you'd come to an acceptance that you wont be able to get your dream and eventually you'll be cool with it and move on with your life - for that dream to suddenly comes to your life once more is an extremely offensive 'fate' if you can call it thatGet what im saying /gig/? No? Okay, its fine, shit like this is posteriori anyway
>Vesna is the only reason the Tea Party assignment was memorable>The new Tsaritsa assignment this week with the focus on Vesna is arguably the only one so far that hasn't further killed the Tsaritsa's characterVesna is the Heart and SOVL of Snezhnaya
Post fap material, /gig/
>>587354426I think Noelle should be given a seat on the knight council but not be given the rank of knight.
I think Cheld should have his balls crushed
Is Danica like, a sailor or something? Why anchors?
>>587354434The traveler was about to job before the Tsaritsa stepped in.
>>587354381They're not Irminsuls they're huge Ley Lyne roots speedreaderGOD
>>587354057Why did she have to die?
>>587354630Orca, whale, moby dick, ship, sea
I think Furina should be put in a diaper and be tucked into bed at night.
>>587354434I agree
Cheld is a famous and well-known councilor/harbinger/warrior throughout Snezhnaya. However, his siblings still know him only as a toy merchant (which he came up on the spot) and doesn't know his real job (concealing it from them is already useless anyway since Fatui/harbinger aren't bad (anymore)). Does no one outside of cheld's family even talk to his brother and sister?
>>587354426I never understood what was HOYO thinking with her lore. The KoF are a bunch of jobbers, so Noelle not being able to join them sounds quite absurd. Am I supposed to believe Fatso can become a KoF but it took Noelle 6 fucking real life years to make it?
*farts*
>>587354801A lot of fans have theorized it's because Noelle lacks self preservation.
This so much this!!!!
>>587354801She's too tard strong to be trusted allegedly, but it's literally just because Jean is a bitch and she keeps on failing Varkek's barrel test
>my fan girl can't help getting on my dick againSo pathetically obsessed
>>587353572>mixed set is betterI regret leveling up my old HoD artifacts for him...
>>587354895Floprina’s story killed the game
>>587354861The thing is that, what has changed since then?She's been pretty static since, so it just feels belated and only because the world nearly blew up
>>587354895holy
>>587354895>properly written conflict
Picking Cheld because he's "/gig/core" was a mistake
LITERALLY NOBODY cares about n*elle
>>587354895BasedFurinaGODS don't want to associate with ya'll
>>587354426>oh shit noelle a couple of churls are approaching mondo we need everyone on board>you're a knight now whatever go gettemAt this point it's an empty title.
touching Furina!
>Based>FurinaGODS don't want to associate with ya'll
The Tsaritsa let Dottore do whatever he wanted for YEARS, and yet we're supposed to pretend it wasn't her fault? Even Pierro avoided any blame, and he was the guy who recruited Dottore in first place.
>>587355179Jeanbro...
>>587354426>if you spent years chasing your dream and failed on doing that, you'd come to an acceptance that you wont be able to get your dream and eventually you'll be cool with it and move on with your life - for that dream to suddenly comes to your life once more is an extremely offensive 'fate' if you can call it thatthis is what forrest gump is all about, literally
>>587355186*cum coloured churlsDon't forget that, it makes them EXTRA dangerous like the grape drank coloured ones....
They are so made that Furinakings want to stay with their kin and don't want to mingle...
>>587354895>xitter>ugly western tranny art profile imageChecks out
>>587355257Jean will be relevant in the patch where they reveal Frederica's moddle
>>587355251T-there's just more pressing matters, like the world ending, which the Tsaritsa also caused...
>>587350496> #NotAllVolkodlaksBut always a Volkodlak
>>587355320>FredericaSeamus Pagpag is one lucky guy
>moddle
Who is Mondstadt's designated Knight of the Cock?
Hey kid, buy me some beer
>>587355254stronger than my varka
>>587354895>>587355018>>587355120>>587355153>>587355180access to White people is not a human right
>>587354895true. trashbina was a mistake
i didn't get the welkin
she's not that big
she's small and cute
>>587355320>Jean will be relevant when they modelcreep and powercreep her Jeanbros...
she'll get bigger
When's he getting an invite to the tea party?
Who's the most forgettable Genshin?
>>587355595 No she won't
>>587355595Down there, sure.
>>587355320Seamus Pegged
Floprinde ... flopped!
>>587355606He's getting invited by Peruere and Nefer and Yelan in Nod Krai and Sandrone will gatecrash it to forcefeed him tea which means he will immediately agree with the Tsaritsa
>>587355606Fat Xiao forgetting about Diluc means his character can never be ruined which is a blessing
Furinafags really believe they are the brahmins of /gig/ and everyone else the dalits
>>587355647Yae miko ugly fox. Even some npcs are remembered better than her.
Sex with kachina
>>587355663surely he looked cooler when he was the number 1 S rank adventurer in Teyvat
>>587355647You now remember Shikanoin Heizou
theres nothing a tea party couldnt fix
>>587355748imagine butthole
>>587355654good, she's perfect
>>587355763
>>587355647Kirara
>>587355786What about Apep's anger or Liloupar's racism?
>>587355842cuckshit
>>587355894Genuinely, how is it cuckshit when they were married and had two kids?
I wish I was Aether
>>587355954you are replying to a varkapag
>>587355961ESL pag
>>587354895>Trannies(unironic) like Shitrina and boring bina
>>587355257Go fuck yourself Nepobaby Jean
>>587355961Same, I'm already 4'11'' and have a micropenis. I'm just missing the white skin!
>>587355647candacedahliaifakachinakavehmikaprunesethosaloyclorindeemilieayatolohenfreminetsigewinne
>>587355975why would a varkafag be into frederica (or seamus)
>>587355894Who's getting cucked?
>>587356063They get izzat from claiming their hero fucks women even doe they are virgins
This general is so easy. Watch this:Furina.
Why does Frederica look like a gigastacey version of Jean?
>>587356085Mince out of nowhere
>got odette>got sandrone>rolled mitya as yae replacement>going to get both danica and tsaritsawould all of those synergize and work together?i will probably run sandrone with mitya, tsaritsa and danica to free odette for a mizuki team right?
>>587356085ah I was replying to the antivarkajeet, figures
>>587355887just send them The Letter, everything will get fixed in one single session of afternoon tea partyThe only one that immune to Tea Party is unironically Wanderer/Scaramouche, that guy is still absolute about hating his own mother
>>587356092
>>587356092...peed herself
>>587356092sex
>>587356159again?
>>587356131Tell 'em VarkaryanOur hero fucked Nicole, Lauma, and even Mavuika. His izzat is off the charts
I like Kokomi.
Imagine getting punched in the gut by Frederica haha
I think Furina SUCKS.
>>587356171>that guy is still absolute about hating his own motherWill be funny if Kanna gets reborn into an actual character and Ei actually likes her, causing more Hat Nigger seethe
>>587356213Hi kokomi
>>587356159Kill yourself
>schizo thinks mindlessly attacking the most popular character with the largest fan base and getting a reply is a huge winMust be nice having such low intelligence
>>587356198Yep
>>587356257>m.jpgWhat are you doing bro
>>587356224Why is she holding her crotch like that
>>587356005
>>587356250I want to put my penis in that thigh gap and thrust back and forward until ejaculation
>>587356261I can smell the izzat from there... oh wait I actually just shat my diapers from liver failure hahaha I should never have been an alcoholic
>>587356303Put the corn down and nobody gets hurt
>>587356198>Our hero fucked Nicole, Lauma, and even Mavuikaalso Jean, Dehya, Beidou
Aether should've had Varka's character model from the beginning
Husband...
>>587356450cuties
>>587356375Feels so good living vicariously through Varka bros... I'm gonna eat curry to celebrate his latest conquest
>>587356453Mika...
>>587356497cute video
>>587356432Aether started jobbing with the Varka model, which looks so worse. His design is already perfect
GTA 6 will cause player numbers to drop.
What if Aether had Kazuha's character model
Who made rn
I find it cute that mika is extremely concerned for loen safety, hes like his adorable little brother. Not to mention that they have similar vision and weapon as well. Bet the writers regretted making huffman the drunkard as mika brother instead of loen
>>587356594So true. I wish I were white and 6'5...
>rig one lottery ticket>proceed to do fuckall while everyone else is doing the hard dangerous work>receive the same reward and merit as everyoneSuch is the life of the banker
>>587356674Trying too hard
>>587356665Both those characters are worthless bricks and shitters and should never have been made in the first place. Also you have aids
>>587355647How should I know if I forget about them?
>>587356250
>>587356723KILL YOURSELF
>>587356767holy based
>>587356723Yeah, like the other anon said: kys
My hero Varka fucked all the women btw... even though I'm a 5'4 virgin from Mumbai...
>>587356723We like Mika here bro
>>587356767u made
>>587356809What's your favorite game?
>>587356594He touched her pits
>>587356849Grand theft auto, sir
UH OHHHH LOHENWORMER MELTY! BRACE FOR SCAT SPAM!
>>587356821whore
>one week in>nobody talks about the current patch anymoreSo much for the much hyped Archon gathering.
>>587356849Skyrim with porn mods. I love playing as a Nord who gets all the women even doe I'm Indian, virgin and short
>>587356723Wormhen is obnoxious as hell but Mika is alright
It's not that I really want to but why can't we actually drive our own train? Besides that one single past event
Jean rape
>>587356921I built him for Euler back when he came out. Even got his C6. Then I realized he can't do shit if there's only 1 enemy on the field and even then he's still worse for phys than C6 Rosaria. Phyiscal really was an afterthought for them
Our Heroes
>>587357005Not on Batman's watch
>>587356626I don't get the hype for GTA. Is it because millennials loved the Sopranos and The Godfather?
Gta 6 is a woke cuckshit slop and yes giggers will enjoy it thoroughly and it will tank genshit beyond repair resulting in genshit 2 being cancelled
>>587356913They didn't even do anything together other than the table meeting and going through the door to meet Nukvah, the latter didn't even have the all the archons.
>>587357067nigger culture is very prevalent in the west so obviously a nigger culture game is very popular
>>587356594Why does a pairing of two conventionally attractive blue eyed blond characters in a heterosexual relationship trigger people so much?
Barbara rape
>>587357036look for BIKE
nicole is my big butt queen
>>587357098pierro pov
>>587355647It's Candace. She uh, likes her village? No personality or feats of note, I don't think she's ever traveled, she just sits in the tiniest possible town and is not any different from an NPC. You use her as much as an NPC too.
>>587357126not everyone needs to be shipped, and OOC stuff tends to annoy fans of the individual characters
>>587357126Whenever you see someone here randomly sneeding out of control over some ship, it's a safe bet it's because they ship one of the characters with someone else
>>587357146zestierro
>>587356913Making the archon that did terrorism all over the world the leader kinda ruined it
>>587356238why would his fans want him to be associated with an badly written character who isn't even popular like pagden
>>587357031mika was actually designed to support freminet back then because the game wants to experiment with physical once more with their newest character freminet and not euler, euler got dragged into the scene simply because shes a physical unit like freminet and mika himself was euler personal shota in lore.If you have played freminet and euler with mika before, you'll find it easier to play mika with freminet instead of euler and your rotation would butterly smooth and linear with freminet compared to with euler though numberimpact-wise euler deals more damage than freminet
>>587357345Why does Euler the useless get to have a personal shota?
>>587357067It gives players a lot of freedom and thus appeals to different people, from wannabe ghetto thugs to those who just want to drive a car and mess around townBut then again I only played Vice City like 2 decades ago and that was enough GTA for me
>>587357332Varka learned how to slay like Niglan divas from Mavuika...
>>587357126A painter from previous century with black hair and black eyes falseflagged the blonde people with his LARP.
>>587357250You shiptroons really are cultists. What if people just don't like your OOC slop?
>>587357412Exhibit A
>>587357289She's the only one who can feasibly contest Phanes
guarantee these varka and nicole larpers don't even have blonde hair because true blonde hair is rare even in northern europe past childhood
>>587357331No one cares about what a bunch of homosexuals and preteen girls want
>>587357345I forgot Fermentation even existed as a character
>>587357387Because shes cryo and almost every cryo lady got their own shota be it a playable character or non playable character - euler have mika, shenhe have chongyun, escoffier have that shota chef student, sandrone have freminet, rosaria have dahlia, citlali have shotaororon, skerk have shotacheld, odette have that one shota in her comic strip if you want to count on that
*has
everyone remembers Freminet
>>587357516>larpers>pluralIt's a singular retard
>your flag>your favorite Genshin ship>>>/bant/25309677
>>587357671sex with both of them
>>587357238That's the problem. You, for example never throw a tantrum like this for other characters with homo ships which make up 99% of the character ships in this game
>swedish flagdefinitely a somali
Contrived was the word I was looking for for the latest AQ.
You fags remind me of Ack whenever you start sobbing about OOC ships
>>587357927We really are this bored arent we? Very well
>>587357990because I typically don't care about male characters, I usually skip them, so they can act OOC all they wantI've shat all over sandbina though for example, you're not special
>british flag>aelalidefinitely a pajeet lol
this was kinda bullshit
The /gig/ council hereby declares Vesna as part of the /gig/core squad
you can't hate this
>>587358089Whose spot is she taking?
>I'm gonna use my Swedish, Filipino and Indonesian VPNs to shill varcoleslopEuropeans really have nothing better to do
>>587358095I don't hate it. I do find it incredibly cringe and embarrassing however.
>>587358095I like it at first but it feels like overproduced slop lately
>>587358095
>>587358059Hi sera
>>587351130Wasn't her voice actress one of the most insufferable SAG-AFTRA leftoids?
>>587358296is that reverse malfoid potter
>>587358350We don't care about EN VAs
>>587358350Yes apparently, but she has a nice voice
>>587358357kind of looks like Aventurine and Stelle in a Harry Potter setting
>EN
Farming for Baizhu made me realise how much better the game was in Sumeru. It fell off in the second half of Sumeru.
>>587358473I prefer Norma
>>587358296>>587358059Kill yourselves or fuck off back to /hsrg/
>>587358385
I'm Brahmin living in a first world country... What are you?
>>587358473OMG hi Fufu!
>>587358528im trans and living in serbia
How could anyone get off to the idea of removing Klee's clothes and licking her tiny body all over, nibbling her neck and kissing her adorable little nipples? Only a heartless monster would think about her cute girlish mouth and tongue wrapped around a thick cock slick with her saliva, pumping in and out of her mouth until it erupts, the cum more than her little throat can swallow. The idea of thick viscous semen overflowing, dribbling down her chin over her flat chest, her tiny hands scooping it all up and watching her suck it off her fingertips is just horrible. You're all a bunch of sick perverts, thinking of spreading her smooth slender thighs, cock poised at the entrance to her pure, tight, virginal pussy, and thrusting in deep as a whimper escapes her lips which are slippery with cum, while her small body shudders from having her cherry taken in one quick stroke. I am disgusted at how you'd get even more excited as you lean over her, listening to her quickening breath, her girlish moans and gasps while you hasten your strokes, her sweet pants warm and moist on your face and her flat chest, shiny with a sheen of fresh sweat, rising and falling rapidly to meet yours. It is truly nasty how you'd run your hands all over her tiny body while you violate her, feeling her nipples hardening against your tongue as you lick her chest, her neck and her armpits, savoring the scent of her skin and sweat while she trembles from the stimulation and as she reaches her climax, hearing her cry out softly as she has her first orgasm while that cock is buried impossibly deep inside her, pulsing violently as an intense amount of hot cum spurts forth and floods through her freshly-deflowered pussy for the first time, filling her womb only to spill out of her with a sickening squelch. And as you lie atop her flushed body, she murmurs breathlessly, "You came so much inside of me, mister", then her fingers dig into your back as she feels your cock hardening inside again. Monsters!
Damn i need this setup as a mobilepag. The shooter slop in genshin really makes me depressed oh and the mavuika autistic combo too
>>587358528im bri ish
>>587358268cuuuuuuuute
>>587358528i work in a scam call center in metro manilla, avatar fag using eula and scream about black tier asses along with black culture on a basket weaving forum.
What am I and what are we? Data clusters shuttling about inside the Simulation.
>>587358515i like Norma, but her CN va so bad. sound like dori but worse
>>587358725We all say this proudly
>>587358528Anything but a jeet.
>>587358482You just have nostalgia goggles. The first desert was good but the rest was honestly middling, and Sumeru essentially made half the playerbase quit by turning their comfy COVID-era BoTW clone into a verbose visual novel wannabe.In that sense, Sumeru presaged Honkai Star Rail
>>587358725kill yourself faggot
>>587358846pinoy bro...
i literally can't stop frotting
>>587358725alive yourself straggot
>>587358864Desert 3 was fun since it didn't have a big WQ roadblock.Personally i think that GI's exploration is overrated. I'm a contrarian fuck but feels like only a few areas are real GOAT areas all around that mog most open world shit, and the rest are more mixed while falling into similar or new trappings that bring them down.
frolicking with /gig/ bros...
Spoiler: furina allogene made it at the end
>>587359040The GOAT areas are>Inazuma>Enkanomiya>Chasm>Desert 1>Fontaine 4.0As you can see it's mostly the Inazuma era that carries this game's exploration
GAA 2...
Wrio won piggly
>>587359230Remove inazuma for Dragonspine.Add in Mona's island from GAA2
>... And then I said, "Floprinde flopped!!!"
wrio won siggie
All fae are descendants of paimon o algo
>>587359331Inazuma deserves it more from my personal POV.Dragonspine was comfy but I'd be more inclined to remove Enkanomiya for it. Sheer Cold never felt like an issue where Inazuma did have some nasty environment mechanics, and is also the only place besides the desert that doesn't shy from portraying a desolate country, which is a breath of fresh air compared to the rest of the game.
Defend this
SUN TZU ONCE SAY "FROPRINDE FROPPED"
>>587359602did he rearry
>>587359406Siggy gave him no choice
>>587358789>The wooden sword found in the Narzissenkreuz Institute, named the Holy Blade of Narzissenkreuz, is more important than any ordinary wooden sword. Perhaps it might be of use when the time is right, just like the Holy Blade in the story.>The materials, four hypothetical substances, are necessary to forge the Holy Blade. They were reproduced by the Ordo in the material world based on the esoteric philosophies of Khaenri'ah & Remuria.>Four types of substance came into being: Memory, Wish, Soul, & Persona. These enigmatic substances are purely experiential. You could say they are even further beyond ordinary logic than elemental power; this is born of the confluence of traditions from Fontaine and technology from Khaenri'ah.>The birth of "reason" requires the merging of the four orthants.
>>587359631Rearry
>>587357527clearly they do because pagden bitchcunt will never be allowed to go near him
Wow, this general stinks.
Any c2 Tsaritsa calcs?
Nobody posted Yae though.
>>587359967Stinko....
Which Genshin characters wear diapers?
>>587359948Other way around retard. Raiden won bigly this patch, meanwhile Wormderer is forever stuck as Hat Guy (more like FAG GUY) and is left in the homosexual quarantine zone known as Shitmeru.
>>587360030kill yourself
>>587358804I play in JP so i wouldn't knowNorma is simply cute
>>587360032What's Kaveh bd doing with the harbingers
>>587360030all the characters that had too much anal sex so their sphincter stopped working
>>587359602Never Stop Rinding
https://poal.me/t3s2jphttps://poal.me/t3s2jphttps://poal.me/t3s2jp
Furina made me want a theater gf
Start a family
>>587360304I'm sterile doe
>>587358385go listen to english neuv combat lines
>>587360281You don't actually want that. Much like cosplay gfs, another thing guys think they want, you'll quickly come to find that only the most mentally unstable and attention hungry women pursue such hobbies.
>Tsaritsa nerfed>people are asking for even more nerfs while already being worse than Odette and every stellar dps>she's going to be the most useless archon meta wiselmaoooooooooooo no one likes her
genshins for each caste?
>>587360476People are asking for Danica nerfs
>>587360487Obesa
>>587360529KEK
>>587360487We have talked about this before. loreslurpers are dalits, explorationGODS are brahmins
Sumeru's culture is fascinating
I honestly wish Indians didn't exist and I didn't have to know words like izzat or bramins or whatever else their trash poo culture comes up with.
>>587360520Danica is her dedicated support, so nerfing her is also just a nerf to Tsaritsa
Paimondalit meltyYou will never have izzat like Varkaryans
>>587359573they keep doing this because people keep falling for itif people collectively decided this is a shitty thing to do and skipped both banners then hoyo would stop doing it
>>587360690everyone says this
>>587360476>she's going to be the most uselessYou guys say this every patch.
when you realise traveler is the teyvat version of kalki who came to end kali yuga (celestia) and restore teyvat's dharma
>>587360737Danica is a a support for sandrone/wrio/Tsaritsa
only dalits hate caste system
>>587360181Not allDottore fixed Pantalone's sphincter for sure
Aino masturbates with her workshop tools
Ineffa is a workshop tool
Is this reddit
Es esto real?
>>587361172>>587361146
The moment I realised my favourite Hoyoverse lolis were Aino and Norma from ZZZ is when I realised I had a type when it comes to little girls
>>587361419Honestly we don't even know if Andromeda or the twink Enjou leaks are real. Could just be leakers getting some fake ass info to post for clout.
>>587361496naviapedo...
>>587361496At least they're not potatoes.
>>587361562>a*no>not a potato
>Primordial OneNarayana (Preserver)>PhanesBrahma (Creator)>The Abyss OrderShiva (Destroyer)
Furina is femcel slop for women. Up to this day I still don't understand what's even the point of her characters aside from getting replaced by a more competent man.
Ineffa Ineffa
Uh oh anti Furina meltie out of absolutely nowhere
>Fischl is canonically after Benet's dickOh no no no
Mitya is too hard to play. I can only remember playing with Alhaitham being this hard.
>>587359551Inazuma's ok visually but I wasn't too big on traversal, time gates or the island navigation. Puzzles weren't really as nuts as I remember, but still way better than most later ones I did appreciate the absolute fuck out of the difficulty and random hazards. Added well to its atmosphere on seirai and yashioriDS is mainly because it kinda didn't hold your hand with its WQ+ visuals and the claymore quest along with how exploring upwards felt fun. It's a small area but just felt well designed. But maybe you're right with Enka, it mostly had the day/night stuff going for it but it felt too fragmented for me
I want to shitpost with danbooru numbers so fucking much, when the fuck is it coming back up???
>>587361694Fat Xiao is manage to make 'Male Archon', using Furina as bait. People stood up, clapped, and cried. It's his best work
>>587361872You don't have to do the autistic rotations, it's only a 4% damage increase>Mitya hE > Odette EE > Valeriy ECQ > Sucrose N1E > Mitya CQC n2 C>AVG: 386k>First Rotation: Odette EE > Mitya tE > Valeriy EQC > Sucrose E > Mitya E CQC n2 > Sucrose N1E Second Rotation: Odette EE > Mitya C tE > Valeriy EQC > Sucrose E > Mitya E CQC n2 > Sucrose N1E>AVG: 402k
>Fat Xiao is manage to make 'Male Archon'
>>587361973
>>587362070That's the average level of discourse among Fontaine haters
>>587362005His best work was actually adapting the Avatar Cycle of Vishnu with Nahida and Rukkhadevata
>>587361872he's only hard if you need to cope with Diona/Qiqi because of how clunky they are to play with Mitya
>>587361913Zhongli killed the website because Columbina was just about to surpass him.
>>587362149nobody cares about trannypoke
>>587361778Doesn't matter because she's still my wife
>>587362070the purpose of language is to relay informationif you understood what he wanted to say then it served its purpose
Man this IT was fucking shit I kept rolling dupe arcana and it took 3 tries before I got death, worse still was my character luck was the worst on the last run too
>>587362030nta but this was helpful, thanks
>>587362005Holy ESL
keep seeing people say you need to swirl electro with sucrose but whenever i swirl electro instead of using qiqi to swirl cryo my dmg goes down a lotis that only for like odette havers or something
We need genshin version of this
>>587355647The one with cactus hair and southern accent from liyue
Bond of AVRA
Lol
>>587362573>frauds
>>587362578They will never EVER show how Furina found and convinced Neuv to come rule fontaine
>>587362616____'_ _ ___
This game has gotten boring to me but I feel like there's nothing better to play on the gacha market
I keep hearing voices
>>587362703Pagther...
>>587362669focalors did
>>587362703bro why did you post your UID?
>>587349637My wife Elyms
>>587362515>using qiqi to swirl cryoThis is not how it works
>>587362669tempted him with her furinussy
>>587362671nuh uh
>>587362676take a breakcoming back to a plethora of new content will give you a fresh experience
>>587355647Troonresa
>>587362669It's in Neuvillette's character storyHe gets a letter from Focalors inviting him to move to FontaineHis whereabouts at the time are kept vague on purpose so honestly kinda farfetched
God i want to fuck sandrone
>>587362676Gacha market nowadays is just copy pasting genshin and that's it
These are my heroes btw
>>587362964She's like a barbie doll
>>587362984Gacha market was always about copying the leader, retardbwo...
OUR HEROES
>>587362676>This game has gotten boring to me >but I feel like there's nothing better to play on the gacha marketAgree on both points
>>587362578That scene was so fucking stupid
>>587362984there are niche gachas that you probably don't even know about
They're niche for a reason
>>587362964Bina...
>>587363120everyone in that picture is so lucky...
>>587362950>a throwaway line about some impersonal letter from his hated usurperI said SHOW nigga there had to be a lot more convincing than that seeing how pissy he was at the archon meeting and that's 500 years after adjusting to human life
Hot take.I don't like the Tsaritsa.
Boobrinde
>niche gachasI dont want to play a png collectorslop
>>587363029Why do people think Xbalanque looks like an adult Mausau?
>popular = goodgo play gta6 jeet
>>587357126To be fair its kind of a crackpairingOutside of Nicole stalking him they dont seem to be close at all
I don't care if Noy is the most turbo meta anemo off field stellar swirl enabler.I'm not pulling any m*les.
I play a niche "png collector" gem with legit great gameplay. Not telling you what it is though.
>>587363543It's okay I'll pull Chasca's father in your stead.
>>587363543Strange of you to keep pictures of him to post then
>guys I am NOT rolling for this character that I have saved an image ofuh-huh
>>587363571He'll flop regardless. Characters marketed towards foids don't sell ;)
We shall be pulling for Noy
Nobody cares about your png collectorslop
No otaku can skip THE Shinichiro Miki
He's in
>>587363665Mitya sold gold
>>587363524jeet means victory and i will
everyone cares about your png collectorkino
>>587363543Nobody actually cares about what other people pull or skip.
>>587363665why did Niglan flop
>you can't download an image for a specific post, you MUST've had it in your folders beforehandAre people here that daft?
I'm not pulling for Danica as i skipped all snezniggers
>>587363120sex...
>>587363710>Roy>Kaiki>UraharaHoly based
>>587363710My niggas Randy and Roy
If you want to collect PNGs then go play Master Duel.
Sandrone doesn't have nipples.
>he downloads the pictures he attaches to his postlol?
>>587363762Half of /gig/ is third worlders who only learned how the internet worked like last year
>>587363710HE IS HIM
I regret choosing Varesa nobody told me how dogshit her targeting is in group combat with more than 3 enemie
>>587363726His numbers were garbo xis
Stfu mincel
EVERYONE ROLLING MITYA
>>587363710Ah, Zamasu. Back when /dbs/ was still good.
>Yae's grippersThey're in
Mitya sold gold
>>587363931Nobody says this>>587363710Everybody says this
>>587363750Tranny region
Everyone skipped MIDya
>>587363896/gig/ warned you repeatedly and told you to pick Clorinde
>>587363896>plays a game with shit targeting>doesn't realise that the character who auto locks would get raped by slop such as floor 9 in IT and other such configsI said this since I rolled on her day 1 btw
>>587363954>Sex catIn
MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA MITYA SOLD GOLD
>>587363889Today I rolled Ronova's arcana card
Shitya sold gold (pyrite)
>>587363997furina fell off...
>>587364024
>mitya can't even outperform Yae at c0Who was this character for? Neither metafags or straight men are pulling for him.
>>587364008*chiori>coperinde
>>587364025>trying to force Shitya to be in the center of next thread's wordcloudpathetic
Genshin isn't a game for metafags
Mitya is for straight men with incredibly high IQ
The more you loudly announce how straight you are the gayer you sound btw
>>587364008I hated trial clorinde in IT too she takes forever to kill anything>>587364017I should have known better...
EVERYONE ROLL MITYA
>>587364081Clorinde is in
Baizhu and Cheld were the only reasonable picks from the anniversary selector.
I'm an incel and mitya broke my mind
Mitya sold antimatter
Pagden is an ugly street worker
>>587363997Those are really good numbers for modern paimon.moe
>>587364269fucking wormhen sold better than that lmao
I rolled mityaI will roll noyI don't believe the second half leaks so probably not enjou or whatever but you bet I'm rolling whoever male shows up
remember that lauma has weird white blood
>>587364076Siggy would do better....
>>587364336everyone on /gig/ says this
>>587364329Pagvuika is a giga flop
uh oh yaetard is not gonna like this
>>587364348erm isnt that just chinese censorship
>>587364421Fvark,..
>>587364336I can see the futureit's pantalone
>>587364231You should be picking Clorinde unless you have her C6
>>587364421>best revenue but not best rankhow does that work?
>>587364472*coughs blood everywhere and croaks*
>>587364532good thing I invested in baizhucoin
>>587364421>3rd of 3 debuts in 7.X>8th of 10 in 2026>53rd of 63 all-time>falling faster than mostKEK WHAT A KWAK
>>587364024Who's that blue-haired fellow on the right?
>>587364348>>587364460I thought it was a reference to the silver unicorn blood in harry potter.
Ronova owes me death
>>587364610Why it is the Commissioner of the Yashiro Commission of course!
>>587364421>falling 6 spots faster than most That means he sold less. QED
>>587364460They still have red blood with other characters
>>587364610Ayato our Genshin
Only Raiden and dong have aura farmed so farNahida a bumFurina a bumMavuika maybeTsaritsa hard carried by her fatui
>>587364792They'll do nothing next patch, this is just preemptive filler
>>587364792Brute force queen
>>587364421Melty incoming
>>587364792>>587364847Xilo Queen trying to big up big Mavuika
>>587364847>meanwhile in reality c3r1 does less damage than C0 Lumi with a 3* bow
>>587364421can someone with brain explain like I'm paimon
>>587364336Only sodomites say this
>>587364891My pic
>>587364903The game isn't canon
>>587364847
>>587364949I've never engaged in sodomy
Last pic
>>587364989Ei is so smart
>>587365121Mavuika: We hit really really hard
>>587365060Yae shinko is so ugly
>>587365084It's true though, even Xilonen was in awe at her craftswomanship
>>587365146But Xilonen should immigrate to Inazuma
>>587365121This is what people think straight men like.
Women don't have aura.
praying danica gets nerfed
>>587365296
I can't take genshin seriously because most of the nations are run by women
>>587362676play real games?
Objectively Raiden is the coolest
>>587365446Nah, Ana is definitely the coldest.
>>587365446Post the latest version of the poll with the flopbike tied with diaperina kek
>>587365606frick I love pierro
Guys I hate how the Tsaritsa turned out so fucking much. Words cannot describe how let down I feel.
>>587365606He is so reddit and unfunny
>>587365679You will roll anyway
>>587365679agenda coded post
>thunderbird just stands there>jobs to raiden instantly>essence trapped in shogunbot>raiden trying to "befriend" itTHIS is the electro sovereign?
>>587365364That's a man.
Was there ever any indication that the gnoses can stop time or was just a total asspull?
>>587365783You'll love Kanna when she is our beloved dragon loli.
Name a cooler genshin Protip: you can't
>>587365861SEXEX
I get bored whenever raiden shogun appears on screen so wasn't paying attention during her segment. what exactly did she do for her nail trial?
>>587365870The gnoses were used to amplify the tsaritsa's cryo energy. Cryo can slow you down. At least that's how I understood it
>>587365783Neuv would perform even worse since electric is super effective against water doe
How come women on average dislike Mavuika and Ei despite being good representation for women?
>>587365783Dragons were all bitches which is why they lost and are still seething.
>>587366005Ei is pretty well-liked among female players
>>587365870The gnoses amplified the Tsaritsa's cold powers from ice magic to conceptual levels and allowed her to slow time.
>>587366005they're written as men
>>587365870Gnosis are just power boosts
>>587366079Raiden/Mavuika: No thought head empty hitting hard never failed me before
>>587365870I believe the implication here is that she needed the gnoses and her lenghty experience JUST to distort Rhinedottir's perception of time enough to succeed.Or it was all Rhinedottir's plan, I think that would be way funnier.
>>587366069
>>587365870It's not the gnoses it's the Tsaritsa's cryo power enhanced by the gnoses and it didn't stop time it slowed the flow of time in a small area. And Dottore did a complete time stop with the moon marrows not sure why you have a problem with time manipulation now and not back then.
>>587366059Did you start playing yesterday? When Inazuma came out Ei was widely hated by women except lesbians who shipped her with Miko. There were shitton of polls showing that the female audience did not like her.
>>587366079The most popular and least popular hag in one pic
My favorite genshin is Nahida
>>587366005Women who play this game are all wokies and think that Mavuika is too pale for the brown people nation archon.
>>587366185Not really
>>587366273Furina: I halped!!!
>>587366005>women on average dislike Mavuika and Eisource for your outlandish claim?
>>587366005Why don't you ask your real question instead of using Ei for your agendaposts?>>587366164People who still care about that shit are an even smaller subset of players than Eimiko "lesbians". Stop larping>shitton of polls showing that the female audienceNow we're just talking out of our asses eh
>>587366270Wanting more men in gacha games is actually the woke opinion, ironically enough the opposite of how it is for most media.
>>587366005Ei is well liked because muh yuri with YaeMavuika isnt because she has 0 yuri
>>587366378>Mavuika isnt because she has 0 yuriXilonen exists
Sex
>>587366480
>>587366360Nga poll from 2022 kekw
Furina (unexpectedly) won, fat xiao wasnt happy with her doing nothing at the end
>>587366005>How come women on average dislike Mavuika and Ei despite being good representation for women?Insecurity. They unironically feel inferior to a fictional women.
>>587365286It was really dumb of Venti to come along if the plan was for Dahlia and Varka to represent him.I guess he just wanted to be present in case Zhongli made a breakthrough so he could inform everyone else as soon as he got the info, but he could have just stayed at a hotel for that purpose.Silly drunkard Archon.
>>587365893
>>587366541Oh wow her story and personality were more popular with female players than fan favorite Childe. Truly female players "hate" her and you're not just being a hyperbolic agendaposting faggot
>>587366378raidentroon was liked because of C2R1. now no one cares
>>587366541all it shows is that female players from your obscure forum dislike female characters you retarded jeet
>>587366554cute aetherwives
Sandbina
Raidentroon quite uppity since their dogshit character finally did something relevant to the game after four years
Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina Sandbina
>>587366780it doesn't even show that they dislike female characters, it only shows that they SAY they dislike themthe only thing that can show what women like or dislike is account data, but hoyo will never release such information
Binasand Binasand
>>587366872>seething indirect reply after getting your ass handed to youKWAB
You niggas do a lot of retarded shit however spamming specific words in walls of text to influence the thread word collage image is right up there with the most autistic
>>587366909>Meanwhile the truth: Female players in total: 1000Male players in total 100000
>>587366872You got xim, king.
cuteden cuted
>raidenfag rejects the agenda post>mavuikafag readily welcomes and even upvotes itnoticing
You now remember Chasca
>>587367102>>587367102>>587367102
>>587367098Raiden fans have nothing to prove.
last for Harry Potter
>>587367098That you're a shitposting troon trying to stir tribal faggotry due a severe addiction to drama and conflict from your antisocial disorders?Yeah, noticing.
>>587367268>agendatroon projection
>early thread when the general isn't even that active
>>587367330>Xhe keeps going in xers sick desperation to start conflictsYou will kill yourself due the misery one day overtaking the little rational thoughts you have left thanks to the depression and crippling loneliness
sustainer waiting room
