pre-santa rally edition>Educational sites:https://www.investopedia.com/https://www.khanacademy.org/economics-finance-domain>Charts/Screeners/Data:https://www.tradingview.comhttps://finviz.com/https://www.investing.com/indices/indices-futureshttps://finance.yahoo.com/https://fintel.io>Live Streams:https://www.newslive.com/american/cnbc.htmlhttps://www.livestreamy.net/bloomberg/>Options:https://www.optionsprofitcalculator.comhttps://optionstrat.com/https://www.optionistics.com/quotes/option-prices>Calendars:https://www.marketwatch.com/economy-politics/calendarhttps://www.earningswhispers.com/calendarhttps://www.cmegroup.com/trading/interest-rates/countdown-to-fomc.html>Boomer Investing:https://www.bogleheads.org/wiki/Getting_startedhttps://bitcoin.org>Anons in troublehttps://www.crsgh.com/blog/object-stuck-in-your-rectum-why-prompt-medical-care-mattershttps://www.psychiatry.org/patients-families/suicide-preventionprevious >>23770540
shut up faggot
no u
green or red id get
my lego gameboy arrived today. cant wait for sunday to put it together. but my favorite goyball team has incurred 3 of their 4 losses this season whenever i put together a lego set during the game
>>23778745i don't really get the Lego models that just look like everyday objectshaven't been into lego since i was a child (not a flex, i have other childish hobbies) but yesterday at the mall i walked past the store and the big Goonies pirate ship playset was in the window and it really drew me ini think because Pirates was my favourite Lego theme as a kid
>>23778762this is my collection so far. im going to use them as end table decorations for my garage smoking hangout lounge. im purposely picking ones that will look alright sitting on a table without it looking like im a total manchild. im avoiding sets that have a bunch of tiny pieces and people to "play" with and going for the standalone statue types.
>>23778745 #>Thing but LegoIt looks kind of cool but what are you actually supposed do with that?Where’s the playability? I could see building with your existing Star Wars kits but to actually buy this? Just weird.
>>23778817See now we’re talking. You could combine those three plant kits into one man eating cannabis plant. Little shop of horrors with a 1960’s hippie vibe.
>>23778817>garage smoking hangout loungeBruh, this game boy is not working man
>>23778826its just a prop to look cool on the end table while you smoke joints in my garage. you cant actually play it but it adds to the ambiance of the environment especially when i have a jailbroken wii-u on a 98 inch TCL QM7 series TV with all the old games from SNES, Genesis, N64, PS1, Gamecube, Wii, and Wii-Ualso picrel is my wishlist that i actually might buy all of these this weekend since i got lucky and made some money on a risky stock this week.
>>23778854damn that is sick and you did that so fast!
My female manager and I after the company Christmas party
>>23778857Well I’m glad you’re profiting and doing what you want. That’s why we’re all here.
>>23778868is bought this for my dad who is considering buying a porsche 'cause he is bored in retirement. when we were kids he would get lego kits for us. hope its not too difficult for him to put together. i didn't realize it had over 1400 pieces when i bought it.
>>23778854
was having a dream. i was with a woman and we were having sex of some kind, wasn't normal, she had to be hooked up to a machine and i had to press a button, so strange, a bunch of other weird stuff happened in the dream too, i had a bunch of zoomers working for me and they all looked up to me like their senpai or something. but anyways that's not what's important, i jumped out of bed again, and the moment i woke up, penelope had posted. that's twice in one day that's happened and it's very odd. she also finally responded to me this morning after so long. anyways right after that my dog puked enormously right in my room, just cleaned that up. account is up 3%, having a big day.
>>23778959up a little over 2%at least the nasdaq ended on highs.
crazy week crazy day. mom left, i'm alone. will be through christmas. oh well. got my doggy, he seems to be sick though. slept a lot today, probably wasn't the best idea but it felt really good. depressed suddenly because i'm alone and the market is closed, but i'll be ok. time for tea and youtube. just bumping the thread because we're on page 8 all of a sudden, /bant/ moving fast out of nowhere.
>>23779735>page 8It's due to this place could use some NIGGERS AND JEWS and FAGGOTS AND TROONS and JEETS and GOOKS and WOMEN poasts to keep it afloats.THA SWIFT ONE could single handedly keep it page 1. Anyone that prays, do so for them. All of us here are in some kind of need whether we are acutely aware of it or not, but SWIFTIE is presently probably the moast in need of us all by far. Concerning ourselves with the needs of our fellows helps alleviate the intensity of focus on our own sufferings, too.
bro it's like hte bitcoin recession out here
Couple new matches. Hoping i can get a message, maybe a date
>>23779992
https://www.youtube.com/watch?v=UDZ6Zp_zGzg
lego order came in. gonna wrap these tomorrow. they sent me an extra kit for a gingerbread train i didnt ask for.bito closed $12.99 and my $14 calls expired worthless. almost bought to close my 2 intc calls but got greedy. still not selling new bito calls until the relief pump. might buy a $10 put or three with the year end dividend to hedge against another leg down.>>23779992>>23779996they are pretty pictures but hard to know if they are real people? what keeps tinder from flooding the space with bots to keep up engagement and subscribers?
>>23780084good question. i imagine if they were bots i'd have an easier time getting matches though, and they might send some messages also. and it is worth a shot. real people do use these apps, people do meet on them. they do have photo verification as well, but these girls aren't verified. better than doing nothing at all.
>>23780105im not knocking you for trying just thinking out loud. hope you get a date.bonus i received was right on the threshold. as if they knew it. it was supposed to go into savings but i need to buy a new car. the subframe is rotting out and the repairs are more than the thing is worth. had to take out a wad of cash for a deposit because the dealer wont accept a check over $5k and i didn’t want to get a cashiers check or do a wire transfer. the bank gave it out mostly in $20 bills and made me feel like a dude weed dealer. the stack is 4” tall but its less than 13k. pussy money (weed not pictured).tempted to make a tinder profile having this as my profile pic with no bio and see what kind of response id get.
>>23778868Thanks. I ended up buying my entire wishlist that I posted earlier. 6 sets for a total of $1177.14 plus they threw in picrel as a freebie. I figured it was worth the hefty price tag for 3 reasons. >1) I made $1000 gambling on pajeets successfully launching a satellite into orbit next week. I relieved my risk and ran with the profits.>2) I feel like I should spend that money on something that calms my autism and keeps me off the Internet for a few hours. There is a dollar value on quality entertainment that isn't just visual goyslop on a screen. >3) That dollar value of the entertainment and the physical merchandise isn't just wasted and depreciated to nothing as it will all be on display in my garage as permanent decorations. So now my collection will be 10 sets, 11 if you include the free fortnight girl they are gifting.
>>23778896>1400 piecesThat looks really cool I bet he's gonna have a blast putting it together even if it takes him days.
>>23780084Nice haul, the Japanese maple was kinda tricky. Pay close attention to the positioning of the branches and leaves. Took a while after I had it together to get it looking like the box and it's because I had branches not in the right position
got a match on bumble too... don't even remember swiping this girl and cannot believe i did. she's not ugly but a total bimbo, fake hair fake lips fake nails tons of makeup. so i guess she is ugly but she's done a lot of work to get over that threshold. also russian who wants a wealthy man. i'm gonna message her because i don't want the elo hit, i'll be sure to bring up the fact i live with mom and don't work. don't want to hurt her or be mean, thinking about how that would make me feel. but this girl isn't the one for me. won't be sharing the picture though, nothing to brag about here. but i'm not shadowbanned on bumble either! good news i guess.
>>23780309yea i guess they are giving out free sets with purchases. they sent me a small train set.>>23780320thanks, i’m giving that one to my sister i’ll let her know
>>23780084KICK ASStreesI got into LEGO back in the 70s and kicked into overdrive with it when they came out with the SPACE sets. I got my son started on it when he was maybe 3-4 and now in nearing his 30s he still has a big wall shelf full of kits displayed at his house. He got addicted to them and I always thought I sure am glad it's this instead of so much other shit it too often is.
>>23778857I would have a lot of fun with that George Floyd tree. It just begging to be customized. >>23780309Sounds like is going to be a fun Christmas at your home. Check out the Lego rewards program if you see your collection growing. I checked out the instructions for the Porsche. That is going to be a long build. >>23779735So you got the mansion to yourself? Noice. Time to start matching with some of those older ladies out there who are just desperate for attention and lonely during the holidays. Lay off the young pretty ones for now.
>>23780401got any pics you can share of the old kits?buying a kit for my dad has a bittersweet irony to it. now im the one holding a job and hes at home playing with legos.
>>23780445No, back then you couldn't see how your pics were going to come out while you were taking them, and then you had to pay good money and wait a few days to see them! I never have seen any pics of my old sets. I mean, other than looking them up on the internets.
>>23780445From the web, I had all of these, and that was pretty much it for my whole life. I still had the moon plates and my son still has those, I think 2 of them, and still had a good many misc parts he still has, but they had been given to my cousin's kids for some years, then partly came back after they "grew out of them", so the completeness and niceness of them was far too rekt for still being "kits". When I gave them to my son it was just basically a junk box of them, to go along with the 4 new big misc LEGO boxes I got him for his starter load.
>>23780458i remember my mom taking her rolls of film to the pharmacy to get developed. never made any sense why the place that dispensed medicine was the same as the film developers.>>23780545those are rad! wish they did more like that. a spacex collab would be cool. a falcon9 or a starship kit would probably sell.
There is more over here.
SPACE is based too bad they made it soi with the movie>spaceship spaceship reddit hurr durr
>>23780579Its general relative lack of ease led to way less pic taking in those days, there wasn't pics of "literally everything". It was a much different mindset in general. A lot of more casually random pics were the result of someone getting a new camera and just wanting to take a few, or someone just fresh "getting into photography" and wanting to take all kinds because they were "seeing frames" everywhere.I suppose SpaceX kits would indeed sell. I mostly built my kits once, then pulled them apart and had bins of all of them and built my own random custom stuff. That's what I encouraged my son to do, and those first 4 boxes were just plain miscellaneous blocks, not kits. I tried to teach him principles of structural integrity, symeticality, and pure creativity, etc.
>>23780623this is why naked candids of college sluts from the very early digicam era are like gold and probably should be traded like nfts
>>23780434>Check out the Lego rewards programI signed up for this purchase. Idk how much more it will grow from here as I'm kind of particular about the sets I purchase. And now I will have to see how it fills out the space after I get them all set up! But yea legos are cool.
>>23780627KEKThat's a very interdasting observation, and you are not wrong about it.
>>23780642i have taken great paints to hold onto my trove from the aughts of my then gf now wifemostly screencapped from MSN Messenger kek... and a lot of 'artsy B&W' sessions i talked her into in college kekvery nice stuff
>>23780659*painsbut kek anyway
I bought my son 4 GIANT Stanley double sided tool boxes with configurable bins and transparent lids to put all of his LEGO parts into. He wound up filling those and then having some of the big plastic storage bins full of them.
>>23780659I've seen them from every decade, and I think pound for pound the 90s ones were best. We had a guy around here that would take girls inside the post office at night and take pics, because you could get into the po box room 24/7. It's such a small, rural area the odds of anyone being in there were next to nothing.
This thread is too much Lego for me>>23780309Why is that +10 with less pieces than the car (my nephew gets it today). That car just by eye's measure looks more complex.There's like a 80-90% chance they raised the age for adult men to not feel bad about themselves.
>>23780695Lol I bought some 8+ ones for my niece who is 6 and I guess she (and her dad for that matter) couldn't figure out how to do it so they are gonna wait for my help lol
>>23780695I thought we could feel bad about ourselves at every age?
>>23779996JUST NOT GERMANIC ENOUGH>>23779992
time for the yank and groan
>>23780740If her Dad helped that's.. yeah.. But with that stuff you generally can go above the adviced age I think. Children can do more than people expect them. There are restrictions, but with time they will adapt and sometimes it is just weeks and they can do the stuff they could not last time.I'll likely also help him with this car, he just got 4. But I also assume that he'd be able to do it himself if I helped him initially.He can't read conventionally yet I think. But last time he was here he read a word of the screen that I don't recall having him explained how to read. I must have said it out loud and he remembered it, pointed at it somewhat and said it (a word in the menu screen of a game).>>23780742Always. I just don't get the fascination with lego. Not as somebody +20-30 and so on. There's other stuff you can build/create. You are the psychologist here, you can tell us why this phenomenon now exists. Obviously for a small child this is interesting. What I always try to remember is if I myself as a child saw things differently to explain their crazy fascination with about everything, like for example dinosaurs etc. But obviously that's not possible, not below 4years old. If I was to remember it's mostly videogames like Resident Evil 1 that I played with 7-8. It must have "looked" different to me as a child back then. Like there's a different perception of reality for the mind of a child and that's very likely a lot stronger with younger age. >>23780743That's OBVIOUSLY an italian. Even with the fuckin hairline spot.
>>23780775>If I was to remember it's mostly videogames like Resident Evil 1 that I played with 7-8. It must have "looked" different to me as a child back then. Like there's a different perception of reality for the mind of a child and that's very likely a lot stronger with younger age.With that I mean, obviously a child's understanding is not on the level of an adult, but I mean also the general perception of reality, that what they see is different from that which you see that's to be seen in reality. Like for example when you take drugs and your perception changes, time slows or speeds up, more clear, less clear and maybe even hallucinations.
>>23780775>But with that stuff you generally can go above the adviced age I think. Children can do more than people expect them.That was sort of my thinking, that its a good healthy activity for the kids since they are already doom scrolling before kindergarten and if they need my help then fine, but if not then also fine
>>23780775I guess yeah I don’t know how I could have made that mistake
>>23780908well she doesn’t look Italian that much for sure but she’s probably to some extent
>>23780912she reminds me of Maria Grande. Who's italian. And greek. And north african. According to her one tweet.
>>23780932Wait no, her name was Ariana, lmaohttps://youtu.be/hn9j8FH8X48?si=62_8WUEg3L83VuSN
>>23780940>>23779992
>>23780755good yank and groan. time now to yank and groan.
>>23780775I personally haven't had anything to do with LEGO since childhood other than turning my son onto it with the goal of having his psyche being exposed to working with those notions I mentioned (structural integrity, symmetricalality, creative exploration, etc.). I thought of it as perhaps the most worthwhile toy of all toys, so it was my duty as a father to give him the best of everything I've learned and "know" for his own development. That was the end of it for me, personally.However, something I studied a /lot/ is Zen, and LEGO can be a /very/ Zen "hobby" for anyone of any age, and in a world as insane as this, Zen is like a refuge for the mind, a place of temporary solace from the onslaughts of literally everything, and a break from doing things in the pursuit of advancement, achievement, acquisition, desperation, improvement, etc.It's just doing a thing because it's enjoyable to do, and essentially anyone can do it essentially any place. You don't have to go out to do it, you don't have to pay more each time you do it (like going to a restaurant, club, zoo, watevs), you don't have to coordinate with others, get others to agree, or interact with/involve others in any way. You can just pull out your LEGO shit, and do it however you want for as long as you want, etc. and it's also, in and of itself, quiet, which is Zen.There's actually a /lot/ more reasons. I could write for days on why I think people of all ages love LEGO. It's breddy gud.
>>23781165>Zen is like a refuge for the mind, a place of temporary solace from the onslaughts of literally everything, and a break from doing things in the pursuit of advancement, achievement, acquisition, desperation, improvement, etc.Yes, that makes sense. The issue is though that LEGO at the same time is a children's toy. So, you can't expect to not get laughed at by others. Even Video Games are due to their complexity socially higher regarded than LEGO when judging a man. And Video Games already have not a great reputation. All that said, you can obviously also just don't care about it. But you also can't demand from others to not judge you based on that information about you. You know, like>Freedom of Speech, not freedom of consequencesIf you were to buy yourself stone, clay and marble or whatever and start sculpting and forming, that would be regarded ENTIRELY different socially and potentially have the same effect on you.If I was to go back or go back, I'd probably get me some stuff as there's space in the yard and maybe do something. Particularly since relatives of me are Sculptors for cemetery graves.>You don't have to go out to do it, you don't have to pay more each time you do itWell, it's quite expensive and you'll also want new stuff after a while, I assume.
>>23781201Wait, this cemetery is fucked. What the hell is even going on there. There's almost no space to walk in between the graves. Absolutely crammed. I've not yet seen one like this, even though the graves themselves look like they actually do.
>>23781201>expensiveOk. what I've done above is simply provide /one/ key /explanation/ of why I understand people doing it, as opposed to an outright /advocation/, and since I do not "do it" myself, also not a self defense, but now you're touching on an aspect that triggers my "other side".Now that my son is full grown and such, I have told him that the LEGO Jews literally pay psychological professionals to sit around brainstorming ways to convince him to go to his job and perform his tasks for countless hours and then give (((them))) the fruits of all of that labor for petroleum with coloring blended into it and hardened into shapes then packaged into boxes with graphics from (((their))) friends at the movie and show studios who take a cut for that aspect and they are all endlessly wealthy thanks to countless millions not only falling for the psyops but being very enthusiastic about it, and then I showed him soiface pics. He seems to think that is just the ramblings of a psychotic old man. So, I told him all about Edward Bernays to show him that no, I actually know WTF I'm talking about here, but nothing seems to put so much as a dent in (((their))) spell.I'm still grateful it's LEGO and not heroin, meth, coke, or OnlyFans whores, tho.
>>23781343> He seems to think that is just the ramblings of a psychotic old man. So, I told him all about Edward Bernays to show him that no, I actually know WTF I'm talking about here, but nothing seems to put so much as a dent in (((their))) spell.I'm sorry for your loss.The brickformed colour-coated-hardened-oil J got him
Got my big ol dick out I'm about to pull back the foreskin OHHHHHHH OOOOOOOOOOOOOOH OʻOOOOOH PLAP PLAP PLAP PLAP
>>23781343at a certain point, lego crossed the threshold from benign children's toy to luxury autism stimulator. i believe that line was the 19.99 price point, but wherever it was we're definitely over it now.
>>23781410not that there's anything wrong with that. though.
Whatever gets you through the night
I think my grandmother sort of looked Japanese a bit I found this photo of a Japanese actress and she looked a lot like her I even showed this to a Japanese women I met and she liked it
it makes sense that my mother is American and French I’ve come to sort of resent her though the years and one thing that I always noticed of her is that she seems almost like she’s too rebellious but she doesn’t know what she’s rebelling against exactly, I have no idea what it would be but I guess that’s why it would be the American Revolution for her because for her like being rebellious is like being too conservative or something but she’s perpetually confused about the difference between liberalism and conservatism I’ve tried to tell her that what she thinks conservatives is more closely resembles classical liberalism but I’ve told her that liberalism is moderate right leaning at times but they think it’s communism so in general she is retarded I guess
i boughted someCUNTRY&WESTOORNvinyl todayREEL CUNTRYnot the fag shit nashville puts out these days
>>23781410men have always enjoyed modeling. look up Northlands. people travel from Europe to visit this warehouse in NJ where they have built one of the largest model sets in the world. and like you said, its not just paying for plastic. you’re buying a few hours of ZEN. like yours, all the kits i had as a kid were eventually broken down into their parts, collected into a couple of large totes, and are waiting on a shelf for the next generation to get old enough to play with them…and not swallow them.
>>23781881i didn't play with lego. had some duplo blocks as a kid but wasn't interested. one year my mom bought some really elaborate dinosaur sets for us for christmas, but i don't think she really got the idea either because she spent all night putting them together for us instead of having us do it. it was nice and i kept it in my room for a couple years before i took it apart on a rainy day and pretended they were battleships in my bathtub. mom got upset about that. i liked tiny warplanes and military vehicles and i would line them up in rows.
>>23781925oh i confused your ID for THA OlLDFAGid be pissed if my mom built my lego set and then told me i couldnt take it apart. and yah i had a similar habit of lining up my trains. had a whole set of Thomas tha Tank Engine characters that worked with pic related. one Christmas my mom gave me a motorized engine that could ride the tracks and pull a train. me and my brother used wooden building blocks to make structures and buildings for the tracks to ride through. we had “ramp” tracks that let you go up and down. i remember building a tower that was probably 3 feet tall and the train had a circuit that went from the floor to the top. good times. did similar stuff with hot wheels and marble works. my dad wasnt around much but in hindsight he did spoil us as much as he could while being absent.
>>23781852it wouldjust about have 2be premaybe 1983@ thavery least
>>23780695>This thread is too much Lego for me
>>23781165The gear sets are also good for demonstrating simple machines. I needed to explain what a differential gear did once and found it a whole lot easier when I just built one that could be played with. The best thing I believe is that it can be taken apart and reused for something else. This plants the idea that nothing is permanent and that is ok. Another life lesson is that it is easier to destroy then to build and the destroyers of the world should not be idolized like the creators and builders.
>>23782247EXCELLENTnotions
>>23782045Yeh I got stuff from theFif DeeznSicks Deez
>>23782049not bad, you won this one
>>23782049That's worthy of being used on /biz, kek
Swiftie mum status?
>>23782432>unwellwas the last word.
>>23782467:(in happy news, my kid has earned their first interest (took me a while to get their account set up)proud dad moment
Took nap. Matched with cute esl girl, photo verified. She said hello.
>>23783325Strong women? That’s it? What’s in her portfolio? Lego or Bionicle? SOXL or SOXS? Cat or Dog? These are things we need to know. >>23781951I would bet poem anon grew up with one of these sets. Hopefully he didn’t break them over his head.
>>23783325>girlSure thing buddy... Keep dreaming
she just sent me her number... 213 area code (money)i am going to have to learn some manners and get some nicer clothes.
>>23783699You're going to let your loneliness and desperation get you lured into a TRAP (and traps are gay) by gangstas that take all your shit and beat you into something indistinguishable from a pile of JEET poo. No genuine human female that looks anywhere close to that has any need to be on MUH APPS.
>>23782758And THA LORD GOD ALMIGHTY said>let that shit>COMPOUND
well, we connected on whatsapp, she asked me how my day was, i told her i had slept through most of it and was going to the gym, and i think she may have lost interest already. asked her about her travels and how her day went, and she didn't answer either question, been silent on me for nearly an hour now. oh well. maybe i should have worked in lego to try to sound more interesting. ups and downs of love. i spotted penelope on /ptg/ earlier, so she's probably still available and in need of my love. the russian girl actually responded to me on bumble too, gotta let her down easy. anyways gonna get to the gym in a few hours, hopefully someone is there to spot me and i can lift heavy, if not, i'll bench 185 and hope things go ok, i think that's a manageable weight for me. if you don't hear from me afterwards though, i was wrong and it wasn't.
>>23783325jarvis, run a full forensic analysis on this image file. cross-reference the metadata, check for anomalies in the pixel structure, and give me a complete rundown on its authenticity. I need a 'yes' or 'no' on whether this has been manipulated.
>>23783341i wish i had a chance to talk to that guy. he is revered in these threads. i dabble but wouldn't consider myself a poet.think bitcoins about to break up for a relief pump.
>>23783893There is FAR MOAR to PA than poems. That motherfucker can GET GETS that match up with the numbers on front of train pics, and I mean CONSISTENTLY, only rarely missing. He has a whole thread of them on another board but told me not to tell where it was again because he doesn't want it to get discovered. If you go to /biz/ and make the request, he's very generous to demonstrate it.
It might be the moast PEAK AUTISM thing I have ever seen.
The only time I ever told where it was was when he went missing, so I'd go there looking for him. Every now and then it would get a new POAST, and I would ask THAT U, PA, and get no response. We all thought he was _, and LEGO ANON did a funeral. I would go to his thread and beg PLEASE COME HOME, PA, and get no response, but every now and then another TRAIN GET would show up, and then one day, he showed up too, back here.
The way I discovered the whole thing was thusly: I used to POAST all kinds of pics. WOMEN IN JET ENGINES, COWBOYS, JOHN WAYNES, PALADINS, NATGAS AND OIL TANKERS, and for a little while, I poasted TRAINS.One day out of nowhere, PA said something close to "at least put some effort into it", and did a TRAIN GET. I was like WAT THA FUCKIN FUCK and he did it moar, and moar, just showing out. I wasINFUCKINGAWEWEEEEEEEEEGER is close enough to NEEEEEGERSand then he told me about his thred.
chatting with oliv... told her my life story basically. she's still responding too. think i'm building a connection here bros. think something is happening. she's really smart. she's a fashion designer and trades crypto, has traveled all over the world.
>>23783964She's probably an AI that's looking to PIG BUTCHER you.
>>23783921i can sort of imagine how you could do that on a slower board. but /biz/ ? some kind of wizardry to pull that off consistently. hope he comes back and does his fireworks.i was dumbfounded by the mariners dood who was able to sift through my old /pol/ posts from years ago and made a reference to them in one of these threads. i had annoyed him and he wanted to spook me. he disappeared after the mariners lost to the bluejays, or he still lurks incognito. either way he is some high level wizard that much i know. i have tried to mind my manners ever since. his is the great eye, ever watchful.
Are we doing movie night?
>>23784050There are some Anons that are very humbling to witness. It is one of the top reasons I come to this web site rather than any other. The tardest of the tards are here, but those who soar are unmatched. It truly encompasses the complete strata of the psyche of humanity. No place less either free nor abstractly bizarre could facilitate it. It very often reminds me of what a NIGGER I am myself.
>>23783921I have seen this image and many like it. I will say its not AI, and while I don't give a fuck and won't argue. Ima just say whatever the image is real, and the movie is probably gay anyway. I've drank a whole bottle of Jameson whiskey and want to fill out the chat box in cy.tube for the duration of whatever the fuck i feel like talking about. New captcha is fucking easy
>>23784068Shut the fuck up with this some and us we cock sucking gattory, some bulkshit and keep lurking faggot.
>>23784101>I have seen this image and many like itThat's because I POASTED all of them.>>23784108NIGGERIGGERGGERGGERERRNIGGER>NIGGERNIGGERFUCKINGJEWEAT SHIT NIGGER FUCKING JEWWYOU TONGUE ROCKERS ANUSYOU ICE CREAM THIEVING NIGGER
>>23784125Happy 7th night of Hanukkah to you too.
>>23784138KEKEKEKKK
>>23784050I don't think you quite understand, btw. I'm not talking about just matching the last two numbers in a dubs. I mean matching the whole fucking number of the trains to the whole fucking number of the POAST to that amount of digits.
>>23784145My camera takes images too large to upload, and im too lazy to figure out how to compress them so ill do it in text.Middle fingerMiddle fingerMiddle fingerMiddle fingerBigger Middle fingerMiddle fingerMiddle fingerMiddle fingerShalom
I’m the mariners anon you speak of but I started getting too angry with people and came close to revealing my power level so I had to remember my training and zen out
>>23784179PRAISE G_dBECAUSE I DO NOTEVER WANT 2 CUR DICKAGAINGAINIGGERJEW
just had the longest talk with olivshe is very special and sweet and i am smiling and trembling with happiness. she is in la for a couple weeks and can't meet up, but she's really cool and i think she likes me too, and i think i've met someone wonderful.
>>23784197https://youtu.be/iac-vLq6tnY?si=EDTpDh_6FUnpOGZ7I don't hate you, I love you, I give you this amd I'll fuck off for a bit.
13 minutes to movie night! Tonite's Kurisimasu Special is The Polar Express (2004)!
>>23784211NIGGERu knothat MELUVSu2 (not tha band thobcthey rGAYAY ujew)
>>23784214I would join in tonight if I wasn't about to start a movie rn with a biological female right here beside me. It's been a while since I came to a movie night, but I couldn't do it while my MIND RE-WIRE experiment was happening because I would just be a NIGGER to you all in the chat even worse than my normal levels of being a NIGGER.
>>23784214Couldn't even find the original. I fucking hate your choices for movie night almost every time.
>>23783325That's a man
Movie night movie night, get in here! Tonite's feature is The Polar EXpress (2004
>>23784245>man*GAYEYE made pic
>>23784239Baggot this type of harassment of movie anon won't be tolerated. I'd hate to get the jannies involved...
>>23784292I already had to tell him that he tongues your anus. Many such cases. Sad!
>>23784296It's a daily occurrence.
>>23783325Also yes, that is in fact a man
>>23784180>remember my trainingBASEDI hope to learn moar from you but it's a constant struggle against my inner NIGGER.
i don't think oliv is a man. you guys are just being mean. but anyways when it rains it pours i guess, because i met a cute girl at the gym tonight too, black girl from africa, so skinny but huge caboose, just massive... still thinking about it. i had her spot me, benched 200, 5, 5, 4, 4. still thinking about penelope too, but it's nice to have options. those other two girls that matched me the other day are smoking hot too, but probably not as smart as oliv, who apparently plays several instruments. also she's obviously rich, which i'm not seeking but it's nice to have a partner that's not expecting you to provide everything for them, even though i could, assuming they could live modestly. oliv travels all over the world though, wears the finest clothes, her parents house is a mansion, she sent me some cute videos. even her cat looks wealthier than me. even better though she's understanding of my situation and thinks i'm a good person, likes me for who i am. so far at least. i'm feeling very lucky and blessed today, had a thought too, all that love i sent out to penelope, she can't absorb it or negate it, just deflect and redirect it, and it seems to have found a better mark. as it is though i still care about her, but if she doesn't want to change i can't make her.
>>23784490There are literally SETS, as in STAGED SETS, in criminal scam compounds, where the ACTORS convince lonely men that they are wealthy, and lure them into PIG BUTCHERING SCAMS. This is ABSOLUTELY REAL FUCKING FACT.YOUHAVEBEENWARNED
>>23784517fair enough. i'll stay wary. she has not asked me for money though and don't think she will. that's the kind of mindset that penelope has, that the world is out to get her and mistreat her and she can't trust people. you don't find love being paranoid, you find it being open, trusting someone and hoping. playing coy and being cagey keeps you safe but it also keeps you lonely. big rewards take big risks.
>>23784517I need you to understand thatiin today’s world, it is done andpeople continue on with their life, with all the benefits theyfeel they have lost.I’ve spoken with these people over the years and the conversation alone should indicate to why it’s ended up like this. So please understand
This is her cutest pic, nice legs
>strong women>women
>>23784777i don't get it either. she speaks perfect english very eloquently on whatsapp. maybe she is using the app in a different language and there is a translation error, maybe using an ai or something. i thought she would be esl but she speaks better than most native speakers, i'll send a screenshot of one of our chats maybe. doesn't really matter though because she only has to make me happy not you.so anyways i just had the best day in a very long time, got a little sleep, hoping to get back there. i do have a little problem though, yesterday morning i didn't have enough love in my life, now i may have to much. there's only room in my heart for one person, i don't feel right chasing two people at once, but i still love penelope, have these other matches and avenues. i've never had this problem before either so i'm no expert on what to do. i'll just try to go forward carefully i guess, but don't want to lose the right one for want of more.
UGHwhat’s this….? *pulls down zipper* *plaps on to table* UGH MY BIG FUCKING COCKUGH UGH UGHUGH!….. PLAP PLAP PLAP PLAP PLAP OH MY BIG COCK OH YES…..
>>23784585ugh strong woman yuck
PLAP…PLAP…PLAP…PLAP*BANGBANGBANGBANGBANG* UGH UGH UGH
>>23784917>because she only has to make me happy not you.Ye, keep us posted.
UGH UGH UGH
>>23785013i plan to for now. feel like i owe you guys the ending to my story, or at least another exciting chapter.i do have to say the asian thing is tough for me. i think she is pretty, but i do prefer caucasian girls. and not only that, i know how hard life is when you aren't chad, don't want my sons if i have them to be ignored by women, have to work extra hard just to have a normal life, i imagine things will be even harder in the future than they are now. then again asia is real, and hapa over there isn't as bad as hapa over here i would guess, and if she's rich that would help a lot too. is what it is though, and i do think asian girls are cute, and i can live with it. they seem to age somewhat better as well, although occasionally white women look very good for a long time if they stay thin and fit and have natural beauty, that's rare though. i've known her for a day. we aren't married yet, thinking far ahead. but that's the way relationships are, you have to lean into them or they go nowhere, what's the point of love if you're not serious? well anyway it does look like a new chapter might be opening for me. gonna try and get a little sleep, think of some stuff to say to her tomorrow. right now i need to stay interesting and charming, pulled it off for 90 minutes yesterday, another test coming.
>>23784553
>>23784554nigger
happy soltstice everyone. about to send a good morning text to someone who will appreciate it. already trying to replace penelope in my heart with oliv, she's a better girl in so many ways and she is fond of me. but it's not easy and it's not something i can just choose. luckily oliv is charming. i did not get to sleep again, been watching netflix, reading over our conversation last night. she shared so much, i thought i was talking too much but really it wasn't enough, i'll try to be more open with her today. i'm nervous she won't like me if she knew how i live. and to be honest that's probably the truth, so i'm going to try to do better. unfortunately today is gonna be another where i sleep a lot during daylight hours, but maybe my excitement to get to know oliv will help me stay awake. know i'm swooning and acting a fool, but love really is the greatest thing, the thing i like best, and i have more hope today than i have in so long.
Seems like the obsesive one poster syndrome has calmed down around here a bit. My folio been doing alright, mostly just contributions with some divvies. VALE up pretty good on top of the divvies so that's nice, still below my 20$ target sell price.also what's with the new captcha?
>>23785621If you can't handle us at our NIGGERSthen we don't want you at our JEWS
kek
haven't heard back from oliv yet today. and no new matches or messages yet either. dog walker showed up today looking HOT, hair done and wearing a very sexy outfit, perfume... i looked a mess and she seemed kinda disappointed in that. mom thinks i should ask her out on a date and i've actually thought about it, but i don't think i could take the embarrassment if she said no and kept showing up every day. just rambling, i have women on my mind obviously.in the meantime though there's still money i need to make, in a lot of leveraged trades at the moment, some breakeven, some down, and need the market to go up. xbi put in a dragonfly doji on the weekly, qqq looks like a hanging man, but the daily chart of that looks really good. have worries that next week will be sour, the santa claus rally is AFTER christmas after all, and the 100b needed for openai might drain all the capital. it was also opex on friday and the monday after is often ugly. otoh it's a short week which is bullish, seems the press has stopped writing endlessly about ai bubble, and we ended things on a very good note last week, so anything could happen. excited for market open, but do have a lot of other things on my mind. gotta run an errand today, and probably should sleep, but don't want to miss a chance to talk to oliv. think she's more likely to be free in the evening though, and she knows i'm thinking about her already. rewatched the videos she sent me last night and she is SO CUTE, i have got to make this work...
jingle balls
chatting with oliv again :) :)
five foot sevennot welcome in heavenfive foot eightalmost m8five foot nine feeling finefive foot tenbest of menfive foot elevenstraight to heavensix foot evenpussies heavin’
>>23785846That's great, BUT WEN TELL US CUNTRY ALBUMS?https://www.youtube.com/watch?v=bEY8ARSGHTU
>niggers>jews
>triggers>(you)s
Futes green. Had a short video call with oliv. SHE IS REAL. I didnt handle it too well but she likes me a lot and showed me love. Gonna call her again tomorrow too.
ownbaw
>>23787544YESSCAMMERSARE REALPEOPLENIGGER
>>23787500WHATALBUMSDID UBUYUYODELERS AND BLUES
>>23778745>>23778817THE WEE BABY JESUS LOVES LEGOS TOO!
>>23787632BLESSED
>>23787637>BLESSEDAND MY GOYBALL TEAM WON. SO MY LEGOS ARE NOW 1-3 ON THE SEASON.
>>23787615i'll tell you oneit wastexritterBLOODontheSADDLE
>>23787694HORY FUCKIN SHETThis is already some of the greatest I have ever heard, and MAN what seriously kick ass cover art.https://www.youtube.com/watch?v=ezQxApEq79k
First time I've heard Boll Weevil post Charlie Patton. Song for song nothing but net so far. THA MERCHANTgot all that tha weevil didn't get.
I love oliv. She is my future wife and i am going to escape 4chan and markets forever and become her love pet
I got my Chanukah bonus at work this week. I think it's time to go back to the slots. I need the power of baggot and schizo anon, I have to win.https://youtu.be/H8ULIw0Zgaw?si=QnBUVSRA0gY6D5Sy
>>23788061>schizo*PIG BUTCHERED
>>23788085I know every fucking jewish curse in the book, would you like me to practice on you?
>>23788086You need to practice every Jewish blessing in the book to keep PIG BUTCHERED anon from losing everything he has to SCAMMERS taking advantage of his loneliness and everything else, which he's either quickly falling for, or trolling and acting like he is.
>>23788097Who is this pig butchered anon, because I take it as an antisemitic remark which is strictly against the rules of 4chan,
>>23788101>>23787877https://en.wikipedia.org/wiki/Romance_scam
>>23788111I am immune to that and anyone in my circle is immune as well from my aura.
>>23788117He is far from immune to it and it's way worse because his mother left him alone for Christmas so he's desperate and they are taking advantage of it. He needs to realize he's being a NIGGER.
>>23788111yes, this is possible. and i'm worried that this is happening to me also :(. but i just won't buy the crypto. simple as. penelope has already stomped on my heart for a year so a woman i've known a few days won't be able to hurt me. if it turns into a scam i will just move on, with a little wisdom gained. i'm staying tactical and realistic, keeping up the swiping, going to the gym still, keeping options open and forging ahead on my mission.
IM PULLING OUT MY DICKIM PULLING IT OUTUGH UGHOH YYYEEEESSSSSSS
>>23788162Maybe you need to put more focus toward the Black girl. She might even be an actually decent human being because she's tired from all the NIGGERS.
HERES MY BIG OL DICKFLOPPIN AROUNDPLOP PLOPOH YES HERE I GO PLAP PLAP PLAP PLAP PLAPPLAP PLAP PLAP PLAP
PLAP PLAP PLAP PLAP PLAPPLAP PLAP PLAP PLAP PLAPPLAP PLAP PLAP PLAP PLAPPLAP PLAP PLAP PLAP PLAPPLAP PLAP PLAP PLAP PLAPPLAP PLAP PLAP PLAP
>>23787632FUCK THIS JESUS BRO
>>23788061What am I even reading here
>>23785846What about plastic surgery?
now i am paranoid i am in a pig butchering scam. kind of sad too. i guess i'll keep my mind open. it does all seem too good to be true, and there are some red flags also. otoh we have video chatted, i know she is real. how many pretty girls that speak english are doing these things? asia is a big place i suppose. and you can do a lot with ai. she spent a lot of time talking with me today though, and i don't seem like a good mark, she knows i live with my mom and don't work, and my profile does not make me seem wealthy. time will tell i guess. in the meantime, this person makes me feel good, like i'm valued and admired. want to stay hopeful. and it's gotten my mind off of a very toxic woman in the meantime. even if she is a scammer, somehow i think it's healthier than thinking about penelope, who has an evil heart and cruel spirit. i will need to stay strong and be careful, but i won't cage up my heart, i'm going to allow myself to hope and try, and stay loving, i won't let these women change me.
anyways back to markets i guess. up over 1% in the pre-premarket, wkey up 10% there, very nice. still early but we've had a lot of false starts and rugpulls, feel like they've done enough scamming and heartbreak on wall street and now it's time for some real goodies. got some sleep earlier, 2.5 hours, and having my smoothie now. gonna make it to the gym and do some cardio, and with any luck get a little more sleep, try to catch some love tomorrow. i got another match on tinder, i messaged her and she messaged me back, but that's all i've done for now, caught up with oliv. this girl seems cuter, smarter, and younger than oliv, but might be another pig butcher scam also, and my heart can only take so much right now. winter holiday does seem like a good time to scam i guess, filters out the lonely and vulnerable like natgas anon said. gonna try and stay optimistic, about the market and love, bearishness has gotten me nothing, but i've gained a lot from hope and trust.
did my cardio... up 1.5 in the pre-premarket now. beginning to anticipate a big day. feeling exhausted, gonna get back into bed, may miss the market open but that is alright, not feeling like exiting trades first thing in the morning, would like to make a nice profit. this has bit me before though several times in the last few months. think the market is finally ready to rally though. on the oliv topic, she has said she would like to see about meeting me after the holidays are over, and she was a little bit nervous and shy about me wanting to get too attached, which are two things i don't thing a pig butchering con would do. we will see though. los angeles isn't too far from me, and if after the new years she still doesn't want to meet, i guess i can move along. spending the holiday in a happy fantasy wouldn't be the worst thing in the world, and although i'm sure i'd be heartbroken if things don't work out, i fall in love so quickly, it's not too much time wasted i guess. anyhow right now i am happy. perhaps deluded but one way or another i need this, if not for real joy then for learning.
>>23788510>this person makes me feel good, like i'm valued and admiredEXACTLYhow itworks
>>23788843time will tell i guess. fool i may be but if she thinks i'm the fool that will give her money she is mistaken.
>>23788868I would be far more cautious than even that concern. You never know what they might be trying to get, even pieces of personal information that can be used for breaking into accounts, etc.
>>23788875true. and i'll be careful about that too. you've helped me prepare for a possible disappointment, and you've strengthened my guard against a scam. thank you for that. but for now i want to try to make this work, enjoy the hope that i've found.
>>23788894I am quite satisfied with that, knowing you are substantially "on guard" and not diving in with retard abandon.
Babe if she isn't letting you smash her pussy she isn't real.
soldedmuhKOLDedbut didn't have much& muhBOILis gettingrektbut I don't have2 much ofthat eitherbc i have not yet seena rite enough place2 buy a bunchSAFELYbc NATGASis thaSAFEtraders choice
nice "stock thread" faggots now stay in your containment zone and never come back to my block again nigga
bigtime day for wkey, biotech, very nice. nasdaq got stepped on early though, intc did a +2% to red move as well. nice to see smaller stuff making new highs, but not happy about being wrong about the nasdaq, for now at least. said hi to penelope, confronted her, or at least what i think was her, on /pol/. she's being a twerp today again. is what it is. feel bad about that but trying to focus on my other prospects. said good morning to oliv, waiting on her to get online.>>23788985i might try a BOIL trade soon, but i'm pretty tied up in tqqq and labu at the moment, and feeling really bullish those. i just don't understand natural gas at all.>>23788989this is the high net worth /smg/. you do not have enough funds to post here.
>>23788997I suggest NOT trying a BOIL trade anytime soon, or EVER. If you have any actual interest in it then what I do suggest is WATCHING NATGAS, BOIL, and KOLD every single day forever before you make any trades, and if you want to try it at all then BUY NO MORE THAN ONE SHARE PER DAY until you absolutely have a clue which is absolutely impossible to even start getting at all in any less than a minimum of THREE MONTHS watching all three of those things very carefully, paying particular attention during contract rolls.PRO TIP: BOIL AND KOLD ARE OWNED AND OPERATED BY LITERAL JEWS
>>23788997well, now that natgas anon has done the heavy lifting on framing your approach to trust but verify, id like to be the first to say that im very glad for you and sincerely wish you the best in your chase. seems Christmas came early for you.in the event that things don't work out i would strongly encourage you to pursue the dog walker. that your mom thinks you should ask her on a date suggests that she has already floated the idea to the girl that her son is single and looking. that she showed up looking dressed to impressed implies interest. so, do keep that in mind if o-face doesn't pan out. in any case, it does give me some Christmas cheer to know that you're not miserable over the holidays. good luck buddy.sending prayers for swiftie and his mom. theirs is not a holly nor jolly Christmas and i am hoping that he finds some measure of comfort from his own family, and in the anons who are thinking of him.with the solstice behind us, the darkest days are also in the rearview. now we start climbing out of it. up here we had unseasonal temps on Friday, almost 50 degrees. it melted all the snow on my drive, and froze over night. the berms along the road fortunately had not completely disappeared and were able to keep my car from sliding off the road, acting like bumpers in a bowling alley. i made it up to the top and did a few round trips to the road and back with my plow truck. it has v-chains which break up the ice into a icey-gravel. which, when it re-freezes, provides excellent traction. i don't bother salting anymore after learning that trick.markets are looking coiled for a move up. bitcoin gave a little of the relief pump i predicted, but i think the push to 100k is still in the cards, maybe after Christmas. still not confident that move would be more than a dead cat bounce, so ill be selling calls aggressively if it happens. second december dividend announced tomorrow, i think. should be around $0.65-$0.75/sh.
>>23789021ya good point. watching the market you trade is key.>>23789023careful on those roads, and thanks. i'll remember to pray for swiftie too, good reminder. think the big thing for crypto is the msci announcement, which i think happens on the 31'st, about whether mstr and other stocks belong in their indices. i have no idea which way it's gonna go. i brought this up to oliv and she said her analyst was gonna give her a trade idea, which was the biggest red flag and why i'm worried now that natgas anon might be right, but then again she might just trade crypto. i'll know soon enough what the truth is. feel stupid even admitting that but i think it's healthy. never been scammed (yet) but i think some people just let it happen out of pride, not wanting to admit to their friends and family that their new girlfriend is stealing from them.
>>23789051>watching the market you trade is keyYeah, no. BOIL and KOLD are very unique FINANCIAL INSTRUMENTS that are far more complex than MUH MARKETS, as is NATGAS itself due to the contract rolls. You can't even "look up and read about" this shit and come away from it with any clue worth a pile of jeet poo.
>>23789051>>23789056>due to the contract rollsOh, and the "decay/slippage" from the leveraging, too.
It's like I always said. With Jews you win.
Trump is going to announce big changes coming to the world. We will be turning our backs on Taiwan, Japan and Worst Korea, so that China can invade and enslave all the other breeds of chink. USA will be allowed to invade Venezuela and Cuba, while Russia gets all of the Ukraine. This will lead to a lasting peace.
with kikesyou yikes
big fan of the pig butcher arc
One of oliv's sketches
>>23789245
TRYING2 SAVE A JEWFROM BEINGA NIGGERhttps://www.verywellmind.com/9-common-scams-to-watch-out-for-8703530https://www.verywellmind.com/what-is-love-bombing-5223611
>>23789255consider that he is so starved for affection and is inadvertently doing the love bombing himself.
https://pulitzercenter.org/stories/inside-romance-scam-compound-and-how-people-get-tricked-being-there
>>23789255>>23789267i am not a love bomber. or at least not in the way that article implies. that's a term of art for a manipulation strategy. i am very affectionate but i stay that way, i'm clingy and needy. i'm not looking to mindbreak these girls, i want love. penelope fits that profile more than me, affection then cruelty, insecure attachment style. i might be getting pig butchered but i'm enjoying the fattening process if that's the case.
>>23789267ye, but at least he's not outright intentionally seeking to scam them and is LEGIT hoping for LEGIT love/"love".
>>23789277i video called her yesterday, she looks just like her pictures, she was in a luxurious room wearing splendid clothes, had styled hair and beautiful nails.
>>23789283NIGGERI TOLD YOU THEY HAVE "FILM SETS" SPECIFICALLY TO TRICK YOU INTO BELIEVING THEY ARE "WELL TO DO". THEY ARE A MULTI BILLION DOLLAR OPERATION. THEY HAVE A BUDGET TO PULL IT OFF.NIGGER>NIGGERNIGGERYOUHAVEBEENWARNED
>>23789283Yo stupid nigger ass is getting cat fished.
TELL "OLIV"2 MEET UFACE 2 FACE @BURGER KINGRIGHT FUCKING NOWOR>SHECAN FUCKRITE ONOFF
>>23789278by love bomber i don't mean you have any malicious intent, just lots of pent up affection that is difficult to contain>>23789291you have him on edge already. if she turns out to be a scammer he could scamher/scammerbaither. a little dopamine goes a long way.
guys stop... our conversation today is not going too great, i mean it is but it's making me feel inadequate. she's talking about her life and it's so glamorous and mine is so boring. she's more likely to get bored with me then scam me i think, but this talk is hitting me from 2 sides.
>>23789337>she's talking about her life and it's so glamorousFAKE>FAKEFAKE& FUCKINGGAY>GAYGAY
Let me know when she gives you her bitcoin wallet address.
and btw i'm talking to another chick right now, she works at microsoft and is from singapore. i'm starting to feel overwhelmed here. oliv is still my first choice, she's teaching me about fashion right now.
santa rall-ACKKKKKKKKKKK
>>23789378it is a gift.
just said some vulnerable, revealing stuff to oliv, really spilled my guts. maybe a little early for that. major ick fuel. but i hope she takes it well, she has been really positive so far. i need a break i think. past my naptime.off the highs of the day too, but up over 1%. think it's important s&p or nasdaq end the days at the highs today, not just the russell, but i'll take that too. i'll have to exit the tqqq trade and look for someplace better to put the money if q's don't end on highs though.
>shedoesn't give a fuck about anything other than what it takes to get her MARK
DO NOTCLICK ANY LINKS>SHESENDSNIGGER>NIGGERNIGGER
>>23789464THIS IS THE PART WHERE YOU WHIP OUT YOUR COCK AND SEND HER A PICTURE OF IT, AND YOU HAVE TO TELL HER YOU WANNA MAKE CREAMFILLED STUFFED OLIVES. IT IS THE ONLY WAY TO REDEEM YOURSELF BRO!!!!~
REboughteda little bit o'KOLDafter NATGASmoved back upTEN CENTSfrom where meSOLD
>>23789486>TEN*TWENNY
>>23789486i'm glad u liekedda AL BOOMold TEX is actually the daddy of JOHNfromFREE'S COOMPANYand another Fun Factthe tidal songfrom da AL BOOMis used to coomedic effectin my favourite classic $DIS attractionda COONTRY BARRSjam(anon) beau REEEEEE
>>23789626YEi knewJACK was his sonsince i wuz achildbut i neverlooked in2 TEXi just grew upwith THREE'S COOMPANYbeing on thaTV& wuz toldbut MANthat ALL BUMis a fuckin'BANGER2 thaDANGERGANGER
>>23789641another 1 i gotted was picture relatablehavent listened to it yet but i fort the cover looked coolbut u might fink ABS TRACK artis too J's
>>23789658AGREEDon tha coverlooking breddy neat& + 2 alsoINCREDIBLElinup ofSONGSnot to mention whenever I think of "old country" I get *real* old but my next level up from that included MARTY ROBBINS and I spot two songs he did. I grew up hearing him on VINYL REKKIDS.
if i ever get my hands on Chris Captcha i will fucking throttle him
>>23789686Babe the new captcha is way easier than the old one.
>>23789658FUCK ITI'll just include THA INFO that what I mean by "old country" to me was defined by the BOX SET from 1952 AMERICAN ANTHOLOGY OF FOLK MUSIC, which was all recorded between 1927 when electric mics GOT GUD and 1932 when the GREAT DEPRESSION reckt the market for those recordings being made and sold in rural general stowes.
TRUMP IS ANNOUNCING IMMINENT INVASION OF THE VENEZUELAN PENNISULA!!!!
I just nooticed there are pressies under the treeTO: DaddyFrom: [redacted]but that kid can't even hold a pen yet so somebody's lying
>>23789720>Rape the bears every day.>Announce invasion after hours / overnight so nobody has time to go short.This is why the market is run by complete niggers.
>>23789741>niggers*JEWS
>>23789734>pressiesGLAD 2 HEARthat there wuz not*penisesunder tha tree4 u
talking to my other match, and unprompted she goes why aren't you at work? why don't you have a job? how do you expect to have a relationship without a job? and honestly i prefer getting pig butchered to that garbage. i hit her back with "i could have a relationship in a tent scrounging food from a dumpster, i think you mean how do i expect a relationship with YOU, and that's for you to answer" and her next reply was like, "oh i am just worried because of what happened to me before," totally evasive and self-deluding nonsense. the hooker was at least straight up with me and gave me a quote.
>>23790103I'll be alone for Christmas too. Thank THA LORD GOD ALMIGHTY there will beNOWOMENALOUDfor a few days.
Daily reminder that desiring to be tethered with women is retarded and there are mass graves of those who made the mistake.
hola negros
>>23790451HOLAOLATINOSAwhere u beenover @/biz/?We have literal actual JEWS here, too. Why didn't you greet (((them)))?
About to call oliv again, quick what should i say to her? I am much better communicating through text, i sound like an autistic retard in person (because i am)
>>23790499Tell herEAT SHITSCAMMING CUNT BITCH
>>23790505probably should have... think you might be right now. ;_;. she didn't really seem enthused on the call, felt like she was interviewing me, it did NOT go well regardless, i got instantly paranoid too, horrible chat. feel stupid and awful right now, think i've been flirting with an ai for two days. i still don't know for sure but i feel like garbage and am disgusted with this right now. should only pursue women that want to meet, have a date, don't believe this out of town nonsense.
>>23790622The VALUE of this LESSON can be PRICELESS if you truly LEARN IT and that, and the fact that you didn't get harmed (in the classical sense) is, as we say, "all that matters". I admire your frankness as well.
>>23790622chicks should pass a sniff test before getting your hopes up.actually sniff them to see if you are HLA compatible. be surreptitious at first. she will probably try to get a whiff herself if she’s interested. when does the dog walker come back?
>>23790641Somewhere around 40 years ago I was given sniff test advice. This was, of course, well before FAKE & GAY whores over the Internets took the matters to whole other levels. It went like this:IF IT SMELLS LIKE FISHDO AS U WISHIF IT SMELLS LIKE COLOGNELEAVE IT ALONEbut I think it still applies, via metaphoricals and such.
think my other match might be a scammer too, i dunno. she's still talking to me after the stuff i said. she wants to facetime tomorrow. i'll give that a try i guess. she ALSO trades crypto and is gonna be out of town for a few days -_-. noticing a pattern here. she seems more real though, said she can be back in town soon. and i haven't 100% given up on oliv. i'll just try and keep cool, keep pressing for a live date. i know i look like the world's biggest fool but i've only parted with affection, not money, and i won't be doing that either. i am drained and in despair right now though.
also just matched with this slut, she might just be trying to push her onlyfans but maybe she needs a stuntman. she didn't reply back. what a world of sleaze. feeling ready to lean into it though. if i can't get love might as well party.
>>23790707NEVERCLICKANYLINKSNEVERANSWERQUESTIONSTHAT CAN BE USED TOBREAK INTOACCOUNTS
>>23790690great adage.absolutely still applies. we evolved to sniff out suitable mates. a woman that looks good in pixels might not sniff well to you. and conversely, a woman you might not look twice at could trigger your monkey brain. attraction is more non physical than most people realize.
>>23790720What you be using to reverse image search to find that?I just matched with a chick that very much also looks like an OF slut, but all my old reverse image searches be failing me.Pic related
>>23790739she had the link in her bio, it didn't show until i matched.
>>23790728That came to me in this way: I was somewhere around maybe 10-12 or so, I don't know, and my girl cousin in her 20s married a guy with a bass boat. I started spending nights over there a lot and going fishin' with him. He fished in Bassmaster tournaments and was no kidding serious about it. He would let me drink Michelob Lights on those nights, and would tell me all the things he thought I might need to know, and that was among it all. It causes me to remember how much it sucks ass to be in a bass boat in the rain with someone driving who gives no fucks about how much ass it sucks and eases not up upon that throttle.
mentally a wreck. it's too late for weights also. gonna get some sleep and just do some cardio late night, try to reset for tomorrow. feel bad because what if i'm wrong, what if you guys just got in my head? but i know you're right, these aren't serious women, i'm being lied to and scammed. doing well on the market though, optimistic for more, and a new year is coming with lots of opportunities for me, mom wants me to take a lot of vacations and i intend to. might cry tonight, will be the first time in a long time but i really need it right now. penelope is out of reach, not right for me anyways. too much of a sucker for this new world of lies. need anime ai wife yesterday.
>>23789478YES WHIP OUT OF YOUR COCK
>>23790866Like I told you, most of the suffering comes from what you're focusing on. You can "pick better things" to focus on and reduce the suffering. Even Buddhism tells you this as a fact of the psyche and orientation. Maybe reading some Zen would do you some good, but of course one must actually practice it, and not only read. Obsessively focusing on things that you crave and cannot force into manifestation will do you no favors.
>>23790892But you forget positive manifestation
>>23790892all i do is suffer. all i do is want. woman is the only thing i want. even if i tried to change my mind my balls remind me of that cruel fact ever few hours. i know full well how terrible and cruel and not worth it they are. it doesn't matter. still want them. can't be happy without one.
>>23790931Those are the words you are telling yourself over and over in many forms, like a program running on a computer, an array of shell scripts. You can CHANGE the words you tell yourself. Carefully construct new arrays of words. This is, in fact, a primary focus of the literature I am writing. Telling yourself that you can't do what I'm saying is part of your scripts, too, btw.
>>23790931>>23790975It is not a fast process btw, but you have to start small, and stick with it every single day, carefully tweaking your new words, and telling them to yourself, paying very close attention to every detail of what those words are, what they mean, and what you want them to do for you. A typical "factoid" on this kind of thing is it takes about 3 months to really /start/ getting noticeable results that are "sticking". It also helps to take up some new "activity", or hobby, or other positive "pursuit".NEUROPLASTICITY
You have to really feel your feelings and emotions because if you just tell yourself they don’t matter or ignore them they could lead to emotional depression and then they got caught up in the limbic system and can cause all kinds of problems
Been really sick for past few days. Lost track of time and lots of fever dreams. I did keep the cat fed and watered but I don’t really remember doing it. I see I also sold some SOXL calls and bought KO on Monday. Good to see I didn’t do anything stupid. >>23790451Hola fellow white man of non Jewish descent >>23790721I just did a questionnaire about which 90’s rock diva I would be. How fucked am I ?
and whether or not she's scamming me, the call went horrible. i am not an easy talker but in these years of loneliness i've become robotic and strange. she asked me a cute question, "what does christmas mean to you," and i was just lost for words. i told her how it made me feel awkwardly, which is terrible, that's the truth, and she was just dumbfounded and confused and hung up on me, diplomatically of course, and afterwards she was really nice, but any normal woman would have been weirded out, so the fact she isn't makes me more certain she's a scammer. like a scammer who is motivated to emotionally connect with me can't even do it, i am fried and cooked.
>>23792102That should have been the easiest question in the world to answer.
