Canonical event editionPrevious human monster relations: >>540099008 Spoilers ahead, proceed at your own Frisk.-DELTARUNE CHAPTER 1-4>https://store.steampowered.com/app/1671210/DELTARUNE/-The Old Game>https://undertale.com-The Old Game's Demo>https://undertale.com/demo-The New Game>https://deltarune.com-The New Game's Progress>https://toby.fangamer.com/newsletters/>https://deltarune.com/#news>https://www.twitlonger.com/show/n_1sqn3p9-Merch>https://www.fangamer.com/collections/undertale>https://www.fangamer.com/collections/deltarune-Books-Undertale Artbook>https://pastebin.com/1MRmU0Gk-Legends of Localization - Undertale>https://pastebin.com/DkZaXMpi-Extra Content>https://undertaleqa.tumblr.com>https://undertale.com/alarmclock>https://deltarune.com/sweepstakes/>https://toby.fangamer.com/newsletters/-Undertale/Deltarune Text Dumps & Screenshots>https://pastebin.com/WG9u1fvH-Undertale Image Collections>https://pastebin.com/g2JqH6Ba-Booru (newly resurrected, please help tag)>https://utg.vidya.pics/-Recommendbin>https://pastebin.com/fsqd5Sa6-Writebins>Current: https://docs.google.com/document/d/1ZaYVvltQ_Rmf-ggszf1bwmYDW2NUcfpTYU7JzfyMhVE>Old: https://writebin.surge.sh-Comicbin>https://pastebin.com/UJpBYSEE-Fangamebin>https://archive.is/iSiFg-/vg/ League team>https://implyingrigged.info/wiki//utg/- Current whiteboard: https://r7.whiteboardfox.com/75990482-1291-3765- Previous whiteboard: https://r8.whiteboardfox.com/86440374-8564-4327- Magma: https://magma.com/d/QiFH9rWyRh- WorldOfText: https://www.ourworldoftext.com/utg-Wanna change the font?>https://rentry.org/utg-font-Thread Template>https://pastebin.com/rTN8SxAw
I LOVE TV!!
>"Ohhhhh Krissyyyyy~"
i still don't get why we fight alvin in ch4
>>540145339He was at home jerkin it
hello i love them
if this iced latte doesn't make my day marginally better immediately I'm changing my name and moving to the Falkland Islands
>>540145468no, for some reason alvin tries to fight you, doesn't he recognize this isn't a dream like noelle and berdley or smth?
>>540145619i haven't had an iced latte in forever. hope it improves your day anon
>>540145619just drank a coolata I think it’s called
>>540145624Anon.
Why's Toby like Gerson I mean Old Man so much these days
i wish i was a hometown monster instead of a souless vessel from the void...
>>540145619I used to do 6 scoops of instant coffee in the morning, I'm surprised my heart hasn't given out, lol
doomin'
>>540145957He's an old man now so he relates to Gerson
>>540145525who are you?
>>540145894what? its literally a turtle with pink hair and only alvin has pink hair, he's on the church and he hides for some reason in the closet n thas why kris won't open it
I love fish
>>540146119I can't handle two of you, dear (deer) god
>>540145812would you do this if it was an option (real)?
>>540146119Fuck off Dark Warchief!https://www.youtube.com/watch?v=0TGHx0M67Jg
Where is the anchooooorrrrr
>>540146014do you shit yourself often by any chance?>>540145525DONK DONK DONK SLOPPA
>>540145957>Why's Toby like Gerson I mean Old Man so much these daysToby seems to use Gerson as a mouthpiece for his own views on writing, so I think it's more than Gerson is becoming like Toby than the other way around.
>>540146119dont answer him lad, autismo will dox you
>>540145773Thanks. It is pretty good, french vanilla...>>540145829Hadn't heard of those but it looks tasty>>540146014Hummingbird lifestyle
i subscribe to the idea that ralsei is a book/manuscript/rosette stone/whatever entailing the true original raw prophecy and that's why he's cursed with knowledge
>>540146221Of course I would do it!
ded
>>540146654I need more fainting goat Ralsei.
>>540146625>''well if you really didn't enjoy it why did you never go limp?''
>https://youtu.be/ZC3SvVbkRTc>A SHADOW ENVELOPS>A QUAINT>LITTLE TOWN.>A TOWN>WHOSE STORIES>ARE YET >TO BE TOLD. >STORIES>OF A COLD>COLD WINTER>THAT IS >YET TO BE>DARKER>THAN >DARK.>A LITTLE TOWN>CALLED>H O M E T O W N >COMING SOON.>HOPEFULLY…..
>>540146654Poor lad chuffed one too many fat darts.What a shame.
>>540145957maybe he always liked gerson but didnt want to overexpose him, so saved him for his magnum opus when he could do him justicepart of my delulu schizotheory that mettaton isn't on the UT main character list because he's going to be a DR main character
>>540146619uhhhh no??? he's a tube of toothpastethe reason why some of susie's sprites in chatper 3 and 4 have white teeth instead of yelloe teeth is because she had a sloppy intense makeout sesh with ralsei when she pulled him away in chapter 2 and he made her teeth squeaky clean
i only just saw the human pronoun war from several threads back and i'm pleased to have completely missed it while it was happening
>>540146619it's a very reasonable theoryour boy is cursed with literacy.
>>540146298No. if anything, I'm constipated
>>540146768
>>540147128must...not...shit...thread
>>540145185Today’s theme is:Post your best Kris/Frisk/Chara and Asgore bonding as parent and child
new krusie kino just dropped
>>540144376Imagine hugging fave's belly when she's pregnant and being a hand for her to squeeze when laying on the couch. Or imagine fave whispering in your ear when she notices how much your friend downstairs appreciates how she looks while pregnant.
>>540147227IT'S JUST ONE OF THOSE DAYShttps://www.youtube.com/watch?v=xJEfxYjvgHM
>>540147229shit... pants... instead!
>>540147295Excellent.
>>540147337this but with tenna
>>540147291child of divorce
>>540147348too many energy drinksi may actually end up shitting myself by accident
>>540147337*he
>>540147291>Beware, cute ahead
>>540147501ralsei would look so cute on Mpreg, he'd make for a great mommy
>>540146265if you don't see the anchor then post it yourseeeeelf
>>540147614the one thing that legitimately annoys me about ts!underswap is that they gave asgore a perpetual coldthe nose doesn't make him look older, it makes him look sick
>>540147659I don't have the imaaaaaaggeeeeee
>>540145624That's not Alvin, that's G-
>>540146019zoomin'
>>540147614>"Try finger,>But hole">...>What does this message mean, Chara? Why did you write this?
https://www.youtube.com/watch?v=vQbmN2eUeUw
>>540147295Cute as all hell
>>540147491I have never met an energy drink that doesn't taste like batteries and isopropyl alcohol. they could never compare to the panty-soaking experience of deeply inhaling into a fresh hot cup of coffee
>>540147976you know what a battery tastes like?
>>540147880coomin'
>>540147976Battat shouldn't you be working right now?
>>540146393you can't dox with information freely shared by the person, retard.>>540146172there were 3, but the first one was a street urchin pedo and unfaithful whore, the second a naive crybaby and the third, number of the holy trinity? here I am.
>>540147295I live for this shit
frisk parents died in a orphanage explosion caused by a jaguar attack
should i work on my thesis or should i goon to Toriel porn for 15 hours?
>>540147830okay but this slow-motion wizard curse is really inconvenieeeeent Reply with your latest work!
personal creations anchor, reply to this with your latest work!
>>540147976coffee tastes like what remains after you burn down a wooden table, then you have to add as much sugar and as much milk as possible before you can actually enjoy it, i don't have time for making that kind of stuff when i need a wake up, get yourself fruit-flavored energy drinks and you'll see that they're quite good, specially on a hot day
>>540148306>>540148362Kiss now
>>540148132bloomin'
Chapter 4 was Toby's way of saying he has terminal wrist ligma and Deltarune won't be finished before he dies so we have to do it ourselves
>>540148306>>540148362lol
>>540148231Frisk had one of these, and the rest is history.
this thread makes my poop the big poop
>>540148306>>540148362I swear this happens more often than not
>>540148467freakin'https://www.youtube.com/watch?v=qqfPx8_u1Js
>>540148467my son after i impregnate ralsei (he's an exact copy of himself just smaller, it comes pre-hatted and everything
>>540148070for some reason I think I do. I put everything into my mouth as a kid so that's not surprising>>540148180shut up Tenna just fell asleep at his desk after eating 12 TV dinners and this is the first chance I've had to go to the bathroom since yesterday>>540148409you have never had a good cup of coffee. Be more adventurous. (and as if energy drinks aren't 80% sugar?)
>>540148731>soon
How would you feel if Spamton and Tenna get back together but then it's revealed they're both related?
>>540148725groovin'https://www.youtube.com/watch?v=qnkuBUAwfe0>>540148731let's make an army of ralseis
>>540148731so is his hat like an umbilical cord?
>>540148731>say your a child molester without saying you're a child molester
pspspsps... c'mere little guy, it's ok
>bigot circus
>>540148924i was younger than the fungang when survey program released, i'm on the clear
I <3 Kress
>>540148924isn't Ralsei like a century old? he saw a ton of shit somehow so.
>>540148653it either happens or no one posts and I think when it happens it discourages people from posting the anchor but it shouldn't. guys. with the power of teamwork and friendship we can get the anchor at the top of threads.
>>540148906feelin'https://www.youtube.com/watch?v=HwHHs42caCA
>>540148906There's a drinking game with Creed music videos where you take a shot or sip every time he clutches his hands together dramatically like he does literally eighteen seconds into that video.This song will drink people under the table with that game in particular and once you know about it you can't stop noticing how much he dramatically clenches his fists. https://www.youtube.com/watch?v=O-fyNgHdmLI
>>540149291Cute.
>>540149171/utg/ if people posted the anchor instead of pointing out the lack of an anchor
>>540149112asrielkrissdessasgorecarolrudyralseisusienoelleclamgirlonionsanpizzapantscattybrattynicecreamalvinficuslickerriverpersonnormalnpcdonutguygonerkidmonsterkidalphystorieldess2imagefriendtheplayercharafriskfloweyundynevesselburgerpantsgasterspamtontennajevilmantleroaringknightdessotheraltaccountgersonplueyrambunadressedelephantanon...
>>540149273Of course you'd know about obscure drinking games. If you treated your body less like a toilet maybe you could find happiness. and I ain't a pajeet, so get running when my tummy rumbles.
>>540149440they put aphrodisiacs in the lake again...
>>540149543
>>540149568I just KNOW her pussy stinks good...
What if Fave said to you>You look the way I smell.
>>540146982>the UT main character listWhat list are you talking about?
>>540149879>I look like the hot air from the back of a tvYeah
>>540149879insulted
>>540148949careful, he carries diseases
>>540149812
>>540148949What is it about Spamton that makes him look like something you kill with your slipper?
>>540148306>>540148362WIP, I believe in the power of the double anchor making this drawing turn out good!The most irresistible man award should go to Tenna
>>540150157
>>540150280Simple yet effective. Nice!
>>540150217roachman, spamton would totally crawl way faster than a middle aged homeless man normally would to hide behind the stovetop the moment you go into the kitchen at 2 am and flick the lightswitch on, kromer pellets on the countertop and multiple pipis ootheca in damp spots under the sink
I don't think /utg/ has ever been more gay furry chatroom than this
>>540150378>>540150475
>>540150475
>>540150280NICE... I want to grab his thighs and press my face right there
>>540150074I'll take him to the vet and get him his big shots so he won't be sick anymore.>>540150217>kill him with your slipperYou have no heart, no soul. You're 100% getting left behind in the rapture tomorrow.
>>540150532Lol you weren't here when the two goatposters were straight up ERPing? This is nothing, you sweet summer child.
>>540149992cuties
>>540150572me and my pillow when i come from a long day at work
>>540150532You are so new it's adorable.
Krusie is just Kris coping with the fact he's never getting Dess back and having her touch him
>>540149961these guys who show up in the lost soul gameplay segment, the centre of the start screen, and also the photo at the end of true pacifist. pretty consistent lineup.why did toby decide a guy you fight at least three times was not a main character? we just dont know
this pic makes me feel incredible things>CAPTCHA: J0YMV>>540150572>>540150578
>>540149879That's fucked up man, I thought we were [Friend Request Accepted]
>>540150280nice. looking forward to seeing it finished.
>>540150532Lol, lmaoGo back to your shithole, tourist-kun
>>540150728kris totally wants dess and asriel totally wants a dragon lady that will stay younger than him for a long time, they should swap
>>540150624https://youtu.be/-HWYX9e2Llg?si=o29cKjgXAVJoD3vQI want a Spamton A Spamton plush to
>>540149879Fishy?
>>540150678beautiful
>>540149879i'd get confused, then blush
>>540150426>>540150624>>540150787Thanks friends 8>[^)] I shall work hard to make it look good
>>540150747Big gentle Suz
>>5401510878>[^)] -|-<
>>540151202O-oh my... is he naked?
>>540150578>>540150683>>540151101
>>540145619I feel better now than I felt this morning. Thank you latte
>>540151509I'm drinking my second cup of coffee right now, and I can feel my heart beating like crazy, I might die
papyrus can't show up because he's too busy doing erp with his long distance gf (2 streets away is too much distance)
>>540150747for me its this one
>>540150737He does show up on the title screen once you've saved Asriel, although that's with a couple others who aren't really "main characters." So it's an interesting point. The fact that we still don't know what the ghost forms of Mettaton and Mad Dummy look like makes it seem that Toby could be setting up a twist.
tobys a fucking fucker bitch bastard retard cunt twat penis shithead cock asshole skank leprosy ridden vile duplicitous scoundrel dick wretch vampire dractoid loser geek nerd dweeb dunderhead doofus and i dont care for him very much
>>540151609the best course of action is to get really panicked about something immediately. the woke left wants you to think it's bad but actually humans can unlock Incredible Hulk powers and they're hiding it from you
>>540151892this is a thesaurus darkner
>"Married life is even cooler than I thought."
who DOESN'T want to impregnate the robot celebrity mettaton
is the whiteboard lagging for anyone else or just me
>>540152269it is getting full
https://www.youtube.com/watch?v=LoroP6ZQCSMehehehehehe He has a bucket on his head
>>540152269Works on my machine (and mobile too) I think it's just you
my hands and feet are cold
>>540147291
>>540152240Maddie
>>540152348just like Fave's womb after I'm done with him
>>540152658give it time. incest will be everyone's kink soon enough
TV big
>>540145334
>>540151509>>540151609I just got a big extra shot latte. Now I have become the big shot. >>540152404https://www.youtube.com/watch?v=Pas-cMsWIgM
Post Sans
>>540152417its working now that I reset my device so I think it was just me but I also do selfishly want a new one because I kind of dont like drawing on super full ones for whatever reason but its up to other anons if they want to make a new one or wait til it expires>>540152348
>>540151881>we still don't know what the ghost forms of Mettaton and Mad Dummy look likefans would crucify Toby for deadfacing them
>>540153496I love this jerk.
>>540152404Love the energyLong time no see. How're you doing?
>>540153317Stop looken' at me with them big old eyes
has anyone made a list of all the memories that appeared on the streamI wasn't able to watch every break
>>540153525>>540151881tbdesu the old theories were that mad mew mew and mettaton didn't have ghost forms because they were spirits that WANTED physical bodies, meanwhile napstablook wants to be a ghost, so they formed their ghost appearance. and Madmewmew and Hapstablook drove to become physical beings
https://www.youtube.com/watch?v=TpcIhm-K1sk
>>540153496when I saw that we were getting an actual fight instead of another fake out I screamed a little
>>540148362doodle
From Toby's own words, Tenna is an ikeoji(handsome middle-aged man)
>>540154107Why didn't Frisk go around it? Is he stupid?
>>540154142I like the way you draw her with tired eyes. https://www.youtube.com/watch?v=HMQKuXhpC7g
>>540149848pretty sure she bare down there
Anyone got a link to the account of the artist who made the Dess knife game comic?
>>540153678
>>540154390Fuck you.
>>540152404you draw this? its very good. sovl
>>540153446>>540153496https://www.youtube.com/watch?v=a5xAnis4lpwI ate his bucket sorry>>540153631I'm sleepy and enjoying being an idiot for the time being
>>540154390Moist...>>540154330tytytytyty
>>540154254Frisk was having too much fun.
>>540154254yes :(
I feel like absolute shit today. I think I'm getting sick. So much for being productive today. Said Fave.
>>540154390obviously
>>540152976FTFY
>>540154390Just because someone is bare it doesn't mean they can't stink down there anymore
>>540153525>Mystery Key is used to unlock Mettaton's house, which is in Waterfall>it was even emphasized as a donation goal in the stream>this sprite is named Mystery Man and found in Waterfall
>>540154485Ty ty, I sometimes draw UT characters wearing bucket. Because haha fave has a bucket on their head.
had a dream I was fucking a pippins and woke up right before I came fuck my stupid life
I think if I've learned anything about friendship, it's to hang in, stay connected, fight for them, and let them fight for you. Don't walk away, don't be distracted, don't be too busy or tired, don't take them for granted. Friends are part of the glue that holds life and faith together. Powerful stuff.https://www.youtube.com/watch?v=RzARg875rro
no one would give a fuck about deltarune if there wasnt any undertale characters in itits practically a completely different game
>>540154902the cum thieving dream invader pippins...
>>540154627Im working ona a meme for this right now.
>>540154997the only deltarune characters people care about are the original ones though
>>540154997I didn't give a fuck about Undertale until after I had played two chapters of Deltarune and wish Deltarune was a fully standalone concept instead of leaning on his old work. I could be proven wrong when Asriel shows up and steals the show in the final act but honestly I could have done without the Undertale connection. Gerson is a real one though, I actually liked that cameo character actually being relevant to the plot more than the other attempts to do the same.
>>540154602unironically I'd love her more if she trolled me that masterfully. I prefer cuddles anyway.
>>540155202>I didn't give a fuck about UndertaleGETOUTGETOUTGETOUTGETOUTGETOUTGETOUTGETOUTGETOUT
https://www.youtube.com/watch?v=s9A0xloTEA0
Eldertuna and TUNDRAEEL were better. I can't believe Toby just gave an indirect shoutout to them with the bubble underwater zone.
>>540155202you don't need to play undertale to understand deltarune. it's not a series you absolute crackbaby. y'know when I was in school little faggots like you were everywhere. ''emo'' I thought they called it? guess who has clinical depression diagnosed and isn't a little defeatist bitch like yourself. Read into Solipsism, it may just help you. Although I doubt it as it requires Dagoth Ur levels of chad to pull off.
>>540153496
>>540155369I played Yume Nikki and Earthbound and old Square games that Toby ripped off, I'm grandfathered into this forsaken fandom unfortunately. Always thought Homestuck was incredibly shit but knew in my heart that Sweet Bro and Hella Jeff was a funny joke, incidentally.
>>540155202>picYou don't like Deltarune either you just like that the game has a furry you can mischaracterize as a stoner femboy and jack off to.
>>540155414the comments underneath that video are horrendous. i really do wish the people that make these types of videos just turn off their comment section.. or at the very least bar all non-japanese from commenting.
>>540155512You should play Chrono Cross, it doesn't require playing Chrono Trigger at all and isn't Chrono Trigger 2. Also read a book, any book. Go back to school, good god. Speaking of gods, I've been slapping the shit out of them in Morrowind and enjoying multiplayer with a friend. Peak gaming experience, Dagoth Ur couldn't possibly hurt me through the gear I enchanted to survive wearing the Mantle of Woe constantly. https://www.youtube.com/watch?v=0RtIsy9AHYE
>>540151881>toby patches gaster in between alphys and mettaton>otherwise does not acknowledge his existence at all
Goddamn I want more real time battles. I love throwing the fuck down.
>>540155512put your name back on, tasquefag autismo/dark_warchieff. did you take it off because doomerfag already told you multiple times not to reply to him so you pretended to be an anon to get past his filter?
>>540154568It’s sick season
I’m terrified at the thought that the doomersai posters are most likely more masculine then me
>>540156013every season is sick season when 36% and counting of the global human population have long covid rot (including toby fox before his dog metamorphosis surgery)
>>540155990kek and how much he kept hammering "You can filter me" spiel.It's either proof that he sometimes pretends to be anon or he is posting from other device.
>>540155990I don't filter anyone, I just ignore 'em when proven to be beneath me.
>>540155990fuck was for a post on another board, my bad.>>540155905....I write books. no I'm sayin' look into anti-chim and solipsism, those ideologies helped me a ton and are helping me a ton. Solipsism is a rather unstable state of mind but it's pure bliss once you can trance/meditate into it for a while.
>>540156232not sure if i am a fan of the glasses in this one
The anniversary stream actually soured my opinion of Toby a bit
>>540156271I already told you to not respond to my posts, and why. You are a gross and unfortunate person and I have absolutely nothing to say to you, your presence here is a taint on the thread.
Why the fuck does heaven wanna start the rapture now? Deltarune isn't finished yet.
>>540156336Why exactly? I've seen a lot of people bumflustered over the extra areas and teasing, but Toby himself just stating "It's all just smoke and mirrors, but you can expand on this yourself" was pretty cool.
>>540156440You only exist because I observe you, you know that right?
>>540156446Don't worry, no one who likes deltarune is getting raptured. We're all sinners
>>540156271Your prose sucks, from every sample I looked at on Amazon. Just boring and not even bad in an entertaining way. I'm surprised you had enough brain cells to publish them under what I presume is a pseudonym, because I'd be embarrassed having that tied to my real name.
>>540156556nta, you're a fag and the only amusement i get from you is watching other anons absolutely despise you
>>540154631>hapstablook the happy ghost
>>540154902Noooo that sounds so sad :( I'm sorry anonCan we have more details of what the dream was like?
>>540156446the Knight did that by, what was it? 5? dark fountains in one place.
>540155512>muh solipsismSolipsism is for retards. Read Kant.
What would happen if Keir Starmer entered the dark world?
Guys the Jockington theme got leaked on soundcloud>sports>https://www.youtube.com/watch?v=LcTneniWmks
kid named solipsism
>>540145334>>540153371idk but I think dess being an utter creep to Kris and somebody that would fuck their own little sister would be fascinating (and hella hot) to see made canon.
>>540156782>The ol whoopee cushion in a youtube video gagSaw it coming, still laughed.
>>540156446what's with everyone saying the rapture is happening soon, what did I miss
>>540156706>mettaton "Tarot card number 17" the sexy robot>mettaton "tarot card number is the Star" the sexy robot>mettaton "same poses in EX form as the Knight? what a delight!" the sexy robot>mettaton "Sliced the arms off the TV, now he's disarmed just like me" the sexy robot
>>540155202cringe for not caring about undertale but based for thinking deltarune should be a standalone concept without any undertale influence
Please dont cry I like your post please dont cr :(
>>540157003Some evangelical fuckers said it was gonna happen today. For some reason.I'm just reminded of that "priest" who said she was sent by god to give that podcaster who got shot a magic tunic and a quiver of arrows of light.Human retardation is eternal.
My ideal sexual scenario is for Ralsei and Noelle to fuck, and me be the Soul passing between them with each thrust, so that I feel what it's like to be Ralsei fucking Noelle and I feel what it's like to be Noelle fucking Ralsei.
>>540157309that priest? Princess Zelda
>>540157325gayyyyyyyyy
>>540154491>enjoying being an idiot for the time beingKinda jealous, honestly
>>540148306>>540148362>>540155091 (me)I did this.
>>540157325Based as fuck.
>>540157048if i made a mettaknight schizoboard would people actually read iti can never tell if i'm too much for you guys
>>540157003you missed the rapture
>>540157514i cant believe toby fox got raptured
>>540157512this is the "too much" containment zone, go for it
>>540157408Relax man, I'm already one so it's hardly any different :)
>>540157512>if i made a mettaknight schizoboard would people actually read itOnly one way to find out
>>540157512you absolutely are never too much for me fellow mettaknight truther
I thought picrel had supposed to been the rapture
>>540157767no that was the end of the world, the rapture is the jeezies getting vacuumed up into daddy's arms and the filthy sinners staying on earth while Jesus battles satan
quick everyone sound off, if any of us got into heaven we gotta get them to ask god who gaster is
>>540157325Bro that is really gay.Go on.
Spamton?Where's Spamton?
>>540157907Toby actually sank underground. Apparently he made a deal with saten for making a influential video game
if i was God, i would be embarrassed by what humans have become and i would've just let Satan place his throne above mine.
>"Dess, it's 7:00 PM... I need to go home for dinner...">"Mmph~... Nah...">"Dess, you've been sniffing my hair and body for hours. Please let me go.">"Mmmh... Nah~...">"Dess..."
>>540157003RFK found a cure for autism, which was God's final exam for mankind. So it's time for us to join him.
>>540157865The way you worded it is hilarious, I don't know shit about religion and religious concepts but to me this will be what the rapture is from now until I die
>>5401569261% chance, 99% faith.
>>540157972he got raptured and has reached [heaven]
explain in a wall of text why and how much you love your boy ralsei
>>540157478I laughed, saved.
>>540158089hecute
Why does Gaster have spooky devil numbers for all his stats
>>540157907"It is easier for an obese Tenna to go through the eye of a needle than for an /utg/ poster to enter the kingdom of God.”
>>540158089I don't.
>>540157865OhI agree with other anon also, you described it very funny
I think mettaknight is completely impossible and would never work in a million yearsBUTI also believe it
>>540158174He's the antichristWere the angel
>>540158089he is very handsome and smells nice
i want picture of spiderman
>>540158070and then kris starves to death
i want a spider of pictureman
>>540158076>>540158226lol thank you, happy to educate
>>540157512There was a mettaknight schizoboard posted a few threads back. Well, more broadly it's about everything suspicious about Mettaton. The creator is still working on it, and I can think of a couple of things worth adding (e.g. BURNING EYES having the Power of NEO leitmotif, the Knight making the IMG_FRIEND laugh before creating a Titan).
>>540158146>>540158297valid>>540158203not nice
I am hearing cats fight outside my house but I am deathly afraid of getting scratched and or hissed at to interrupt.
You HAVE defeated 10 year anniversary Sans, right?
>>540158432Nah he ate something else...
>>540158089Would.
The Weird Route Soul parallels Lucifer.
am i stupid?
>>540158612Sure did, it's a great "fight"
>>540158767:)
>>540158612i still haven't defeated regular sans for all these years i gave up and simply watched a youtube video for rest of the way through
>>540158089I'll be honest, I still don't trust RalseiI don't like how he slammed the CH1 behind after we left his castlethat was kinda unneeded
>>540157675I don't believe thatStill, it's great to just 'turn off' and have a good time
>>540158593hissing won't hurt you, just run at them flailing your arms going "AOUAHGAOUUGH!!!!" and they'll break up
>>540158612I haven't even defeated my 10th anniversary depression yet.
>>540158912But what if they team up against me and get cool capes and stuff and then proceed to kick my ass?
i kräve french friez
>>540158537I want to pet the goat boy and call him CUTE before requesting that he tries some Kaizo rom hacks.
>>540158198/utg/ meetup at the 2nd circle of hellwhos coming
>>540158997make fun of the capes, their ego is their weakness
>>540159182I'll be in full spamton cosplay
>>540158767Yeah, but it's okay, I'm stupid too.But I can be brave as well.Actually sound off motherfuckers: What's your SOUL color? Have a stupid doodle I did a few years back during a prompt of "cooking"I just want to see people draw their SOULs and how they see themselves doing stupid shit
speaking of animals, scientists should direct all funding and manpower towards making animals be extremely intelligent and have the ability to speak
>>540159182there already was an irl utg meetup though, and we are not doing THAT again, i don't want to pay child support to 15-20 more women again
>>540159384If I wear a Tenna cosplay can we make out sloppy style
So Ralsei is a prophet, correct? If he delivers the prophecy...>>540159554tell me the story, that sounds interesting as fuck (like picrel, tasque/jevil's offspring)
>>540159615goes without saying
>>540158089He is sweet. Looks so cute. Has a lovely smile. Soft and fluffy. Smells good. Great singing voice. BEANS! Bashful which is adorable. Makes you yummy cakes. Hosts tea parties. Has a nice tushy. Is UwU. Gives you a lift in his Mercedes Benz anytime. Wants nothing but the best for you.
>>540159869based and cute <3
>>540159869why specifically a Mercedes Benz?
>>540160027
>>540159554I don't believe there was one
>>540159857See you in hell.
i want ralsei to use my mouth as a fucktoy
>>540158198I'm imagining looking at the eye of a needle under a microscope and seeing little microscopic obese Tennas crawling around and doing the cabbage dance, like waterbears.
>>540160229
>>540160337o7
kiddo... innocent charityPUSH TIME
>>540160603
>>540160450life could be a dream
>>540160726
>>540160809wee
>>540160854
>>540160815Gives me Porky Minch vibes.
do we have no ralsei drawfags? I never see them on the whiteboard
we need more ralsei/reader stories
>>540160970
>>540160991There's one here that drew the fluffy boy recently. >>540130538
>>540161072
>>540160991most of them with some exceptions just ERP all day with the same images, they're not interested in anything creative or the game at large
>>540161186>>540161210>angy
>>540160991I'll make a Ralsie image because I git an idea. I'm not a fan of Ralsie but ill play my gatetax this one time.
new whiteboard???
>>540155202BasedUndertale's cast is boring as shit and people majorly like them because of headcanons
>>540159554Don't lie retard, there has never been a utg meetup
>>540161297
>>540161426:)>>540161481:D
>>540161567
I wonder how many of you guys used to be bronies
>>540160815>>540160971gives me ash zombie from morrowind vibes
>>540161297pathetic.
>>540161706Never been one, but I was a furry when I was younger
>>540161694<3>>540161725oh he angy
>>540161706*slowly raises hand*
>>540161706I'm a girl so it doesn't count
>>540161392 (me)*Goat tax. I hate my faster than mind fingers sometimes. Just type fast, don't spell check, and post and than cringe at the fuck up
>>540161865
>Toby: b-but little Anon I got you a nice Deltarune goat at hom->Anon: NO I WANT THAT ONE!!!!!! WAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAHHH
>>540161706Not me but I did have sex with one
>>540161878trans?
>>540157668>>540157689>>540157713hell yeah >>540158259embrace...>>540158459i regret to inform you that is me and i still need to update it, there's old ones floating around, thank you though
>>540161907sunshine goat my beloved>>540161923emo darkness goat my beloved
>>540162023no you fucking faggot
>>540161995storytime anon? pls?
>>540161923Will Asriel beg for our mercy in the Weird Route just like he did in the Genocide route?
>>540161878>>540162153Boobies or begone!Please.
kill femboys
>>540161706...used?
>>540162065Sunshine on the outside but darkness on the inside.
>>540161706I have no idea how boys and male teenagers actually got to watch that show. Wouldn't you be embarrassed of it? It's impossible to share it to anyone you know
>>540161706my favorite ponies when I was younger were fluttershy and chrysalis and I'm pretty sure you can derive 90% of my media tastes from that
>>540162153Anon, when you're here no one will ever believe you're a biological female. Too many people got burned. It's just safer to assume everyone is a man
>>540161706Not a brony but I did encase one in cement in 2013
>>540162268(WAKE ME UP)WAKE ME UP INSIDE(CANT WAKE UP)
>>540162321if i showed undertale to any of my family members they'd think i was literally retarded
>>540162213But what does anyone get back for posting boobers? Gotta give something in return, it's a 2 way street you know?
>>540162213Fine. just this once. https://files.catbox.moe/pepfal.jpg
>>540162153no I wasn't asking it like a good thing, more like precaution. Did you know many of them don't even finish their transition? I want dicks on my men and vags on my women. outside of that I don't care but come on.... commit to the bit, trans folk. >>540162213Display thyne mammaries or vacate the location, miss>>540162328starlight glimmer, I was on a crossroads: Dessfag or Tasquefag, went Tasquefag as I'm afraid Toby may ruin Dess' character.
>>540162339you can tell theyre female by their interests and the way that they are. trannies are literally retarded and have no ability especially on here to pass as female even through their typing
>>540162372same
>>540162416My mom said the undertale stream looked like "mario for babies" and she was right
>>540162339>meanwhile, Tangy
>>540162321by the time I was a teenager I'd learned it was best not to show things I liked to family or friends, which is how I ended up being the kind of person who'd post in an undertale thread on 4chan
>>540162194There's not really a story. I just had a relationship with one and we had sex a few times. It wasn't good but I had no self worth and wanted to make him happy. After a while he became very mean and I left when he started to act violently.
>>540162518You.You're alright.
>>540162495Boobie poster is the turd, anons are these shiny green flies. I feel worship is a fair trade?>>540162565I met a ton of them and this is true, only got 2 left as my friends as they're chill. One is a flat turbo autist in IT security, other an ADHD haver that's very easy to piss off but she has a good heart and always comes to apologize in the end. Trannies are more often than not, emotionally volatile.
>>540161706Not me, I remember my friends going crazy over MLP but I personally never got the appeal. I watched 2 episodes to try and like it but I thought it was a snoozefest so I was never able to get into it.
>>540162401WAKE ME UPBEFORE YOU GO-GO
>>540162321I made my boyfriend watch MLP and he became a fan, his favorite is Twilight
I get that Kris's Dark World would have a Yume Nikki style guilt hell zone but why is it inside a gatcha ball machine
>>540162797we're no strangers to looooveyou know the rules, and so do ia full commitments what im, thinking ofyou wouldn't get this from, any other guy
>>540162745for context you a girl or a dude? tons of gays here so. we even got an incel that hates women and is gay.>>540162321took my twilgiht plushie to university on a dare (moroccan gangster dared me to) he and his group respected me for it and the girls found it cute or respected me for the confidence. shame is useless, rid yourself of it.
>>540162950To keep it locked away from us.
are we allowed to talk about honse show or will jannies kill us
>>540162416 I think there's a pretty big difference from Undertale and a show made for girls under 10 years old when it comes to optics from an unknowing normal person
>>540153062YOUR TAKING TOO TOO
>>540163002>for context you a girl or a dude?girl
>>540163058ban's 3 days, and you instantly get it for images. talking is warns first. don't ask, I know.
>>540162778>I feel worship is a fair trade?That's not even a guarantee, you're more likely to see people making fun of you or try to put you down whenever you post any of your physical "features" on this site.>>540163058I don't think it's a good idea to do it, some jannies can be really anal about it if you're unlucky.
>>540162565>and the way that they arehttps://youtu.be/_d8mjam7KG8
>>540162321The only person I told were my mom and brother, who were both pretty chill about it (a lot of the embarrassment faded once my brother reminded me he was an unironic Twilight fan). I think the fact that the entire rest of my extended family found out when my mom put pony stuff on my christmas list. This is part of why I have trust issues.
I'm genderfluid but I just present as a male because exploring it outside of text it is way too much hassle.
>>540162992
>>540145185Someone should add https://ut10-battle.undertale.com/ to the extra content section.
>>540162321if I’ve learned anything about /co/ products it’s that it probably attracts the most disproportionate demographics of all time
* Where are the Charas.
>>540163342That's for the template anon to add, hopefully they see it
>>540153062cutie
>>540163335
>>540148306>>540148362https://files.catbox.moe/tzvmjq.pngHis body still has a capacity, surely…
>>540163424
>>540162262go back to your faggoty den you horsefucker >>>/mlp/
>>540163476what is goot feeling sad about?>>540163552
>>540163306are you me? did i post this and forget about it?
>>540163582no :) I like it herealso the only character I want to fuck is Discord
>>540163531You never fail to amaze and terrify me.
>>540163531waow...
>>540163613
>>540163396>you did so?No, I can proudly say I have never, but I've seen people post themselves time and time again and there's really no compliments unless the one posting has features that are 8/10 or above. So again, no reason to post booba unless you know you're objectively hot.
>>540163531damn
>>540163058I just got unbanned for three days for forgetting and using a horse reaction image outside of containment so I wouldn't risk it
Kris doesn't even like Ralsie why would he care, if I told Ralsei to keep smilling. I fucking hate every meme produced by this community, it's like they haven't played the game.
>>540163758
>>540163531holy fuck
>>540163824frankly after all this time, I think that rule should be removed. Bronies aren't nearly as obnoxious as they used to be.
>>540163859
I wish I felt comfortable showing stuff to my parents the way some of you can. To be able to talk about the stuff I like without fear of judgment or being dismissed as childish or wasting time. Even just a couple weeks ago my mom made a half joking yet passive aggressive dig about me "playing video games all night" when I outright out-earn her. And then she wonders why I'm not super sharing?
>>540163838if you tell ralsei that, kris keeps not giving a shit about ralsei. toby took the time to code that into the tea
>>540163954
>>540164053that minigun has 2 magazines and thus 2 feeds, I can tell this was made an European like me.
>>540164053
>>540163613no more content...
>>540163058I once posted a picture with a fraction of a horse that I didn't even notice and took a hit
we need a new whiteboard
>>540164201>>540164223asriel will be SAVEd
>>540164201ralsei uses stock only because he runs hoovy full time and doesn't fight
>>540150883I wish Spamton would make me his weird indentured servant.
>>540164315
>>540164227I once posted MTT in horse form because it was a very clear shitpost but was still struck regardless, even if what I typed was also UTDR shitpost adjacent and didn't have a single mention to the horse show
>>540164315Not in Undertale at least.Undertale is done. Finished.It's over.
>>540163531I was hoping you’d draw something with this scene and this is even better than I expected somehow
>>540164404
spamtenna son
>>540163531YEEEES
>>540164538
>>540164282Make one anyone can do it
>>540164508we WILL see asriel again, we WILL save him>>540164615
>>540164430mtt horse...>>540164545i'll allow it!
>>540163935I think bronies should be oppressed to the point they are nothing more than a memory.
>>540164723
>>540164836friendship is magic anon, Ralsei would love the show
>>540164841
>>540164723FACT: Ralsei won't be saved. He will disappear on screen like that imaginary friend from Inside Out saying his goodbye to (You) as you shut down Deltarune for the last time.
>>540164943
>>540163531Weaponized fetish art to scare tourists
>>540164981ralsei will be stoned and mettaton will throw him on a trash dump in waterfall. trust
>>540161405>>540164282I am your new and improved whiteboard(if anyone has any good ideas for whiteboard prompts go ahead I always think its really fun when everyone does the same prompt)https://r2.whiteboardfox.com/25014173-8233-4091
>>540164981ralsei is save, deal with it>>540165049
>>540165084ty anon
>>540163960Maybe your parents being that way is why you outearn your mom instead of being unemployed or part time min wage like most of /utg/.
>>540165126
>>540165356
I like when Ralsei trolls Susie it's funny
>>540165446Gotta go now. Thanks for posting with me! Here's The Big One for the end!Byeeee! :)
>>540165665thank you for posting with me :Dsee you tomorrow fren, bye bye :D
>>540165126>picNO
>>540165847>tiltedargument invalidated
>>540165126>>540165847>>540165934FOR FUCKS SAKE
>>540166071Sanswich...
>>540166071should have Carol teaming up with Toriel
>>540163960I'm in a similar situation. I remember trying to share my interests with my parents multiple times but I was always mocked and outright bullied by them as if they were my highschool bullies. I confronted my mom about it one day because it was starting to genuinely affect me emotionally but I didn't even get an apology, just a bullshit "justification" and now my mom wonders why I don't ever share things with her or wanna talk to her anymore. My stepfather gives me shit to this day over liking vidya, always with comments that go something like "you know adults don't play those things, right?"I'm a little jealous of everyone that can consider their parents as friends and can rely on them for personal things. I only have you guys and my single irl friend to talk about my interests.
>>540154254*she
>>540164981>He will disappear on screen like that imaginary friend from Inside Out saying his goodbye to (You) as you shut down Deltarune for the last time.Nah, he'll just not show up in a chapter and because of circumstances Susie will never be able to bring this up even to herself, thus he is forgotten and moved on from
>>540165084ok i tried idk if its a good one though haha other anons can decide if they want to do it or not
>>540166279>>540163960I had shame, but you can train shame away. external stressors shouldn't dictate your life anons, be like me, cringe but free. I can give some advice if you want to embark on this path?
>MIKE>Michael>Michael is the archangel who will defeat lucifer and throw him in the lake of fire>number of the beast is 666>Gaster's number motif is 666WHAT DOES IT MEAN
>ywn be the sweet meat in a Ralsei+Susie cuddle sandwichJust fucking kill me
>>540167068why is he flaccid
>>540167040it means mike is going to throw gaster into the lake with a pair of concrete shoes
Deltarune will release tomorrow. Change my mind
>>540167040Keep in mind the number of Chara and therefore the UT angel is 999If 9 represents destruction, 6 could represent creation
>>540167118just finished snortin his shit crazy style
>>540167040Michael and Lucifer are commonly portrayed in modern media as being brothers/rivals with similar appearances, as both are originally Archangels and direct creations of God.Maybe MIKE is Gaster's rival?
>>540167326lucifer was either a cherubim or a seraphim according to tradition but I forgot
>>5401670406 isn't inherent inherently evil, just imperfect
Finally finished Ch 3 last nightFelt shorter than the others, is Ch 4 as short?Also when does Ch 5 come out
>>540148362Made another little comic. In this one, Kris takes a wrong turn and commits a legally dubious act.
>>54016727469...
>>540167631>is chapter 4 as shortlongest chapter (i think, i can't remember how long 2 actually was)>when 5play 4 first then come back. now stop looking at the thread!!!
>>540167827>play 4 first then come back. now stop looking at the thread!!!Im trying but the pictures are cool
>pixeldrain com/u/whCyFZgZ
>>540167040someone remind mewhy was MIKE such a fandom meme that toby felt the need to address it with a whole seperate area?
>>540167638what is this a comic for ants (pls re-upload anon)
I think Ralsei would be better if he had a long tail with a gun at the end
>>540168019Because Spamton singled him out vaguely
>>5401678272 was long as hell man
>>540168019>Why did the defacto Sans of Undertale vaguely eluding to a mysterious guy from his mysterious past arouse fandom intrest? I can't tell you.
What if Fave suffered total twink death?
>>540168019
>>540168124Remove the m.jpg and replace it with .png
>>540168187
>>540168187How can a robot suffer from twink death?
>>540168187Fave reclassed from twink to hunk as part of the goal to achieve the final form of silver fox
>>540168405>Ralsei completely done with this shit>Soul tiredly loading a gunExcellent
>>540168214oh... i forgot how insane everyone got in hiatus....i thought people thought tenna WAS mike though
>>540168124No problem, I'll do a panel-by-panel just in case.
>>540168436mettaton will find a way
Good night, anons. Have a lovely day!
>>540168214susie's dad = everyman = mike = gaster's brother
>>540168736
https://poipiku.com/10591333/12240163.htmlSome Spamton/Tenna comic, don't feel like catboxing it >>540168865I hope you have a nice dream.
>>540164981>The man who couldn't kill Tenna when at its most thematic is suddenly going to kill Ralsei
Not everyone can be Toby Fox. And Toby Fox should know that. But it’s what’s implied by saying that a fan work on Undertale will be equivalent to something he produced. I know he meant it to be encouraging. But at a time when a lot of people are under massive stress, suggesting “you could make this stuff too” easily comes over as substantiation of the old right-wing saw of “since you could have succeeded and didn’t, your mundane life is your own fault, and nobody needs to care about making your mundane life crappier because it’s all on your failure anyway.” Whereas accepting that most people will just be stuck with mediocrity blocks that argument. Fox saying "if you feel unsatisfied, pull your socks up and make things" can easily feel a lot like Paris Hilton saying "if you're poor, pull your socks up and get money", just with money swapped for creativity. It sounds encouraging but it's really ultra-conservative, because it blocks out any sympathy or allowance for a group by arguing that they either don't exist or it's just their choice.
>>540168967
gerson boom might be making me turn into a homo
>>540169092most spiritually Tumblr post of all time
i'm probably sleep deprived but 'Hired his own assassination and forgot about it' is the funniest fucking thing i've ever read, well done whiteboardfag
>>540168758Mettaton schemed to break up Spamton and Tenna and turn them old, but they only turned into stronger sexymen
>>540169170
pluey butt
>>540169092great man theory proved right again
>>540169092To sum it up, Toby Fox is unironically saying "Let them eat cake".
>>540163378
>>540169383
>>540169420made for grabbing
>>540169627uoh.
>>540165084>spamton neo's fart slave (car exhaust asphyxiation)ideal way to die
I drew the goat so my goat tax is payed and i got this idea out of my head.
>>540164512I really hope I’m not the only one so far who has drawn fat spamton gorging on that fry. It’s a very obvious thing to do
>>540169593*waddles in*
>>540169092this is bait ut so many people have been like this unironically all nodraws either must become draws or die
>>540169631
>>540169092Not only that but for some people having to create the story themself kills a lot of what they want out of it. How are you supposed to experience the intrigue and mystery if you yourself are the one writing the answer? You arent sitting down trying to piece together a puzzle, you're drawing the picture and then cutting it into jigsaws which is a fundamentally different experience. I would never get what I wanted out of Deltarune if the future chapters never released and I had to be the only arbiter of what answer was right or wrong
>>540163531squeezing fat fry spamtons belly and it feels like the inside of a big soft fry.incredible work, frankly it's cute. you ever draw so sorry exploding from fat yet? I feel like youre the only person who could do it justice
>>540169857
>>540169092Sounds like you just need to pull yourself up by the bootstraps and stop pretending everything's not your fault.
https://poipiku.com/1349397/12241902.htmlhttps://files.catbox.moe/dy7rkk.jpeghttps://files.catbox.moe/fvrpqw.jpegPink Addison/Mob
>>540170023Painteranon's skills would be wasted drawing fanart for so sorry, the fat retard can commission more art of his fetish OC himself
>>540170053
>>540170217paintfag should do the best picture of so sorry anyone's ever seen and email it to him 5 pixels at a time like it's a hostage
>>540170360And that's it. Thank you for tuning into Amateur MS Paint Theatre.
>>540167638Oh my god, that's adorable.
>>540169765There's a lot of fry fanart but not nearly enough of the aftermath>>540170217>>540170023considering not just his behavior with the kickstarter undertale stuff itself but also his pedogroomer discord cult shit involvement, i do not think he deserves iton the other hand, i am picturing the vile butterdragon being vanquished and slain medieval style by fat spamtenna knights, and it would be kinography
>>540167638aww
>>540169765I wanted to see how your particular creative talent would realize it, and you really delivered ;)
>>540170638Also I appreciate how you draw Susie with a massive fucking snoot. Keep up the good work.
bros i want to make a spaghetti code solo dev game and move to Japan with millions of dollars too. is it too late for it?
>>540163531And just like that all my memories of Super DeepThroat resurfaced at once
>>540170023>frankly it's cute.Despite the kinda disturbing scenario, I think so, too. I much prefer how I’m drawing spamton’s face now, as opposed to the absolute mistake of the slender headed ones I was doing before. Stylization is not always a good idea :grimace:I’m not touching so sorry with a 10 foot pole unless I was offered 10 gorillion kromer>>540170502Fucking kek
>>540170941Are you still alive? If yes. Then it is not too late.
Post Chara, Frisk or Kris in their underwear (or in their birthday suit)
>>540170941no...now you are to work at mcdonald...
>>540171045I liked the long slender ones too, but a healthy Spamton should absolutely store fat in his big head to insulate it
>>540170638why did spamton draw a swastika on the side of the dumpster with his name
The only way Krusie makes any sense to me is that Kris has a lot more control over their actions than they let on, anything beyond basic movement or interaction is dinstinctly Kris's intention and the player has no control over that.
>>540171036wow thats a throwback I used to jack off to superdeepthroat vids so much as a (redacted) idk why i think the animations and tactileness of moving the slider back and forth are still pretty hot despite the fugly art style. weren't there mods? :thinking:
>>540171227what's with the horses
>>540171114
>>540171305I need more
>>540163531his hair looks so fluffy
>>540170646>>540170217I also dont think he deserves it but its not like he would ever see it here (maybe??) I just think painteranon would draw that yellow dragon thing really well. completely understand though. its like how you can never draw anything tasque here otherwise tasquefag may get some residual happiness off it >>540171045I liked your old spammys too but this ones cute, his head shape changes all the time anyways in canon
>>540169092You should try anyways.
>>540170646>>540170775Gald you liked it!>>540170904My belief is that Suz needs to look like she could bite a car in half.>>540171191He heard great things about the Sun symbol bringing fortune.
>>540169092fuck you toby. i'm going to rip you off completely and by your own thieving principles you'll have to be ok with it
>>540171771>My belief is that Suz needs to look like she could bite a car in half.Hell yeah.
>>540171261there so many mods for that fucking game man. It was probably the main draw for most folks but it was in it for the runny mascara and spit
>>540171809>by your own thieving principlesIf you consider inspiration to be theft, then literally all works of fiction are stolen.
>>540170904A power sshniffer
>>540171967Make sure to steal from Toby and a bunch of other games you like.Woops you just made something original because you made it your own.
>>540172127Detecting Kris' poopy diaper from miles away.
>>540172274That's literally how it works. For everyone. Few ideas are truly original or unique. There is nothing new under the sun.
>>540171398
>>540171227Smart Falcon what are you doing here
>>540172418Yeah, that's why I'm encouraging him to do it. Inspiration is cool.
>>540172418 (Me)You should focus on telling a compelling story rather than trying to make something that's 100% original. At the heart of it, everything you make is subconsciously inspired by something else you like. Whether it be intentional or not. It's about how you tell the tale, not how many times it's been told.
>makes fun of Togore both days>rigs the voting for Chara>the extra content was basically a mod, but you can’t play it because “the game is perfect as it is :)”>Toby imploring us to make new original shitBoth streams were 4 hours of Toby Fox shitting on fan contentif you have ever made a mod, fangame, fanfiction, Toby Fox probably fucking hates you
>>540173019no toby just didn’t like the shit meme he had zero problems with yellow and supported it.
Kris is cute and funny.
>>540173212Dess...
>>540173019I want Toby to make a schizo boss for this type of anon (Goob anons)
why are you so fucking negative all the time
540173019bait post but i think it's more like "make fan content but don't be afraid to mix in what YOU want to see." you can steal things as a base but then give it your own spin and artistic flair
>>540173212Yeah
>>540173019I wouldnt go as far as to say he hates fan content outright, I think he's just being extremely hypocritical by trying to "encourage" people to write their own stuff but doing a very poor job at hiding what it is he wants specifically. He obviously wanted Chara to win so that Asriel's new dialogue would actually mean something because that was going to be the only way people could see it, but tried to make it look like it was their choice to do so. Togore in particular was the worst name to have for it because Togore is written as another Asriel sibling so all the emotion would be directed to a character that doesnt exist rather than Chara under a different nameThough I wouldve loved to see Toby seethe over the reality where his writing is completely tarnished because people wrote what they wanted and he just has to live with it, but we all know he was donating under Chara's name so that was never going to happen
>the extra content was basically a mod, but you can’t play it because “the game is perfect as it is :)”All the doors, roads, and npcs they didn't interact with didn't actually go anywhere. They were framework for (you) to imagine what's there.If they released the stream build it wouldn't answer any of your questions, and would just be a broken unfinished version of the game instead of having more than usual.buy a pack of pencils and a sketch/note book. pirate photoshop. download game maker. just do it.
I feel like if Toby or someone else on the dev team posts on /utg/ it's to make stupid fucking bait posts
i keep looking at people's art of bigshot spamton and getting horny because i want to have sex with him but i also feel bad because they make him look nothing like actual spamton so i feel like a fake fan
>>540173908damn one of those autists they showed off at the end of the stream has totally browsed here before lol
>>540173736>They were framework for (you) to imagine what's there.At first I thought the whole concept was>DUDE WHAT IF THIS IS THE ORIGINAL GAME BEFORE GASTERFUCKERY JUST LIKE THE MANTLE AND TENNA'S GAMEBut, nah. The 'dog was just having a laff seeing the fans lose their shit. The extra areas in home and new home are no less than a gag than wayne's spamton. There's nothing deeper to it.
>>540174016welcome
I still think the name voting thing was an extremely dumb idea. If it was Toby's idea himself he needs a smack upside the head.If it was fangamer's idea, they need to be smacked upside the head.Fuck it, everyone needs to be smacked. LINE UP YOU FUCKING NERDS.
>>540173908
>>540173972if he has the pointy spamton nose it's fine. part of the magic of SPAMTON is that he is spam and can occupy anything as a vessel of his good will, and the BIG SHOT was scattered across time and space, into countless versions>>540174097wayne's spamton is deep lore though. spamton "A" spamton comes before spamton "G" spamton in the alphabet, and yet "A" acts as a human servant to fulfill "G"'s plans, traveling dimensions to use the LoadedDisk on his behalf. where else have we seen an "A" be the successor of a "G"? Alphys and Gaster, Alphys and Gerson. not to mention the other characters whose names start with an A (Asriel, Asgore)
if one of them is here rn tell us what tobys hair smelled like
>>540173019>supports undertale yellow>has a character in DELTARUNE imply several times that fanfiction and reinterpretations aren't inherently lesser than the work they're based on>outright says during the stream that he likes the fanfiction and is proud of his fansI think you're just being negative
>>540174313Hussie juice
>>540173972I don't see why it'd make you a fake fan when you like him regardless of how he looks when drawn by different artists. Ugly or ikemen...doesn't really matter. Its still Spamton.
>>540173972bigshot spamton looks so different from puppet spamton that his own business partner didn't recognize him. He looked good enough to have his face plastered on his own posters and merch.
>>540173972>imagebloodied and beaten spamton makes me feel some kind of wayI treat big shot/pre-schizo spamton as an au type thing and I think its ok for people to have a bit of creative freedom with him since we don't know how he really looked before then. I'm also horny for hobo creature spamtong though as well.
>>540174347>Toby telling his fans they're proud of them during the emotional climax>Encouraging everyone to expand the underground during the walkbackBoth of those hit me hard.
>>540174418>>540174396>>540174290>>540173972if he doesn't look like this, it's not Spamton
>>540174450to me there are universes where spamton looked really different as a big shot, but then other ones where he just looked almost exactly physically the same but is treated like he drastically changed
>>540174161Im fairly certain it was Toby's idea because he made the exact same mistake letting us name them at all a decade ago, we're supposed to name Chara after us but doing so makes the game make less sense
>>540145334The last thing 13 year old kris saw before losing his virginity
I love stylizing characters! I love expanding on a character's appearance beyond what the limited graphics of the original story is able to provide, but still fully based on what is already there!
>>540174857homestuck fan aren't you
>>540173972every spamton is hot, free yourself
>>540156926>f/fFaggotry
>>540174959I tried to read it once a while ago and couldn't make it past the first page because it honestly looks like shit
>>540173212only one of those is true
>>540174347>Papyrus says headcanons aren't wrong>Jongler Mike says something can be correct just on the basis of looking coolMike Trio = Skeleton Trio = Toby's hands
>>540175102ok well it only looks like shit because you didnt get past the first pageit has its charms
>>540175496I've seen later scenes floating around the internet, none of them are very visually appealing. that and the whole typing quirk thing
tasteful nudity should be allowed to get posted on blue boards at the very least i think
god bless this animator
>>540175734i think /a/ allowed nipples a while ago dunno why it was just there
>>540175734give us an inch and we'll take a mile
>>540173705>hypocriticalYou're an idiot. "Fuck off and do your own thing, leech" isn't hypocrisy. It's Toby trying to be nice.
>>540172430Nice
>>540175739100k+ likes on a Krusie post, truly a hetgem
Why didn't Sans just use his bulldozer in his geno fight? Is he stupid?
>>540175734>>540175845if jannys ban me for this i swear to god
The forbidden romance
>>540173170Yellow put in the effort. Most fan content is garbage. Always is.
>>540176096ohf god ffffduuuuckk
>>540175739>"So, like, this marriage stuff is kinda dumb and all, but we apparently get tax benefits or something.">"cool">"So... you're game?">"yup">"Neat.">"...">both squeeing internally
>>540176096Seccsy lil spam moobies
>>540175734fully clothed erotica is hotter anyways
>>540176096oh lord I'm about to bust
>>540176130ewwwwww bug sex
>>540176149do you really get tax benefits just for being married? wtf is this medieval shit.
I KNOW WHAT GOD REALLY WANTS DAMMIT HE WANTS ME TO KILL MY MOTHAFUCKIN SELF
>>540176149>"I'm with stupid.">"Me too!"
>>540176465Honestly, no idea, my guess is as good as Susie's.
>>540176435Monster Spamton would be a hot dog harpy
requesting spamtonions
>>540176713they might have a mutual FRIEND
>>540176713
>>540177026based thank you
>>540176960>I'm going to investigate, y'hear!>Come back here tomorrow, y'hear!>Doesn't show up in Chapter 4.RIP.
>>540174856chart who did everyone lose their virginity with>Kris: asriel if female, dess if male>Susie: virgin, somehow, maybe ralsei in ch4's ending if she isn't saving herself for noelle>Ralsei: fucked raw by the narrative for hours on end>Lancer: beyond sex>Seam: jevil>Roulx: elnina and lanino>Sweetcapncakes: eachother>Spamton: tenna>Swatch: tasque>Tasque manager: swatchling>Clover: ralsei>Jevil: himself>King: Queen (don't ask where lancer came from)>Berdly: Kris, only in pacifist>Queen: King>GIGA queen: trash machine>Lanino and Elnina: elnina and lanino>Mantle/ERAM: minikriss>Ramb: unnamed home werewire>Mike:Mike>Tenna: Mikes and spamton with a bit of ramb, it's complicated>Roaring knight: The player>Miss mizzle: 1000 cuptains>Jackenstein: miss mizzle>Old man: ms boom and unnamed human lady at the same time, what a chad>Toriel: ''asgore'' yeah yeah sure it was your first time you social drinker>Bratty: stranger, in exchange of a hamburger>Catty: stranger, in exchange of a glamburger>Cat dad: monster that eats your arm after you fuck it>QC: grillby>Undyne: Asgore, one off thing>Alphys: those ovaries are drying up, alphys>Noelle: susie in pacifist, the player forma de kris in weird route>Temmie: annoying dog, that's where the egg comes from>Catti: jockington, also with kris during their satanic ritual>Monster kid and Snowdrake: eachother, they were experimenting>Jockington: catti, technically didn't get his dick wet as he used its whole body from the half up>Alvin: bow of chastity>Rudy: asgore during college>Nicecream: waiting for pizzapants>Pizzapants: fucked over by life, still on dry spell>Sans: dinner bunny in the last world, toriel in this one>Asgore: Don't ask him>Naptstablook: no ammount of pussy or cock would fix him>Maddie: papyrus>Mettaton: somehow, nothing in this universe>Papyrus: Maddie>Gaster: fucking with the entire fanbase community for the past ten years
the Verse Sans gag is setup for establishing that the skeletons can do poetry and rhyme because of the Gaster poem
>>540177435oh rightfor dess it was asriel, but catty got to him firstonionsan got gangbanged by the potato club
>>540177435Fem Kris is a virgin.
Why do they run like Naruto
alright UTG im gonna hit a FATTTT rip of that green hehhehehehheh
>>540177850>"Looks like a goddamn preschooler">"I don't need that kind of reputation"
>>540178026Tenna doesn't beat them enough
>>540178061smoking straight battat plastic giving my lungs lamination
I'm going to delete my Undertale images folder.
fave wonders aloud what the best free DAWs are if there are any or if they should just pirate frootyloops like toby did hmmm fave from undertale deltarune is wondering what to do about this
>>540178098this would be hotter if the genders were swapped
>>540178253melting a bunch of pippins on a cooking pot and inhaling that acrylic plastic fume resin
>>540178061What like this?
Reminder that is canon that Kris grabbed a firm, but loving handful of Ralsei's butt
Breath of Fire Barbuary FRIEND pointed tail theory was actually directly hinted by Toby1:14:05 on the Twitch VOD from day 1>he gave the creators of Pusheen a demo of Deltarune>he convinced them to play it by saying its similar to Breath of Fire 2>if you can't make Friends with my game try breath of fire
YouTube tells me this is what Toby looks like nowadays. Did I miss something? When the hell did he turn into an Arab?
>>540177496more Susie Gaster evidence
>youtube account got caught by ai age verification for watching Deltarune videosWith all the doelestation and depraved shit on here I forgot that it's technically a kid's game. Fell right into their trap
>>540178330dess...>>540178405>when the computer fans finally start spinning again
>>540178491Susie is poor and hungry, Toby. I get it.
>>540178472he got covid
im learning italian, is there an italian translation of undertale or deltarune?
>>540178502no way is this shit still going around i thought they did it for like a day a month ago.what a retard world we are that i have to now be anxious 24/7 about if i watched enough mature content on youtube recently or not so their scuffed dumbass ai will not flag me.
having too many deltarune dreams againspamton was in this one, he was forcing me to take huffs from a asthma inhaler full of something that he called [AGENT ORANGE], eventually i was given the option to hug him or force my cock down his throat, i hugged him and he transformed into a rubber chicken version of himself which was cooing for some reasonthen i felt a tug in my asshole and i woke up
>>540177435>Cat dad: monster that eats your arm after you fuck itkek
>>540178458
>>540178705mama mia ima pizzey the pizzaina dis world itsa kill or be killeda
>>540178705I think there is a mod of that for Undertale. I think it was called Spaghetti project or something??
>>540178405Fuck off>>540178253We're straight smoking on that Battat Surprise, shits got me seeing Friend Inside Me.Down in the depths I saw the shadow boogie man and I told him to sit the fuck down, this shit is nothing to me man.
>>540178819yousa proceeda da doea
>>540178502The AI doesn't flag you for watching children's content. It flags you for watching content children watch. If there is some depraved shit that caters to 13 year olds and you binge that all day long, you will get flagged no matter how inappropriate it is.
>>540178491"quiet people piss me off"LIKE HER DAD holy shit
>>540178502>>540178721Reminder to use your browser's incognito mode when watching stuff on youtube often to dodge tracking bullshit.
>>540178731he wanted to be pushing buddies with you
>>540178502>>540178721that zog shit hasn't caught me yet but it is awful that is a thing. honestly at this point i couldn't give a rats fucking arse if a child gets groomed by pedophiles on the internet anymore. in-fact, just remove all age verification and put the blame on the parents of the children that do get groomed or whatever. a £50,000 fine and their children taken off them forever if convicted that they let their child on the internet unsupervised. we'll see how quick the parents will actually care about their childrens well being then instead of just putting an ipad in-front of their faces and ignoring them all day.
old tv
>>540178889I don't feel so good
>>540178468interestingly after this plot point Ryu's entire hometown forgets he ever existed there
>>540178949You'd think it helps, but for some reason it carries over for me.
>>540148306>>540148362>>540176713Ok. You asked for it.
>>540179046handsome old man husband...
>>540178731You just spoiled Toby's next anniversary Spamton bit.
>>540179040Well said.
>undertale is a dog game>deltarune is a cat gamehas anyone else realized this
>>540178705Undertalehttps://undertaleita.net/Deltarunehttps://undertaleita.net/deltarune.htmlDon't know how good it is, I haven't played it.
Do you think Toby will do another stream or sweepstakes like event again eventually?
>>540176960>Onion-san (Undertale) was miserable because of overcrowding>Met Onion-san (Deltarune) and prayed his fate would be different since he’s technically free>Arguably more miserable than his Undertale counterpart (trapped, lonely, forgot his own name, can be bullied by Kris/Susie, goes missing)Why does Toby hate this guy, specifically
>>540179040>>540178949>>540178721what i dont understand is why these silicon valley dumbfucks deployed a feature world wide due to a new law in the fucking UK (and a few other EU countries)this shit is literally not my problem. its an awful ruling but why do i suffer the consequences of the votes of citizens of other countries? fucking hell
>>540179373>look inside undertale>cats>look inside deltarune>dogsmmmh...anon?
>>540179456please dont moan at my posts
>>540179046Tenna with wrinkle lines is peak
I forgot that autumn officially began yesterday... happy Deltarune season everyone. https://youtu.be/q9I_YLvcN00?list=RDq9I_YLvcN00
>>540179410because whataboutthekidsism still tugs at moralfags hearts and is a massive campaign slogan. that shit is a issue on the left and on the right. people don't want to take accountability anymore and just want the government to tell them what to do.
>>540179127very cool
>>540178731>he was forcing me to take huffs from a asthma inhaler full of something that he called [AGENT ORANGE]Canon compliant behavior
The new fights feel like a flash game ngl
A strange sense of emptiness just hit me knowing that 10th anniversary was probably the last we'll ever see of UT, especially with that message at the end
>>540179386deltarune 10th anniversary>>540179691we might get some tidbits of post-true pacifist with the characters waving hi or hanging out once spoilers for their deltarune versions' plot arcs are no longer an issueremember, your heart is the ark
Suselle but 30 years into the future and their relationship resembles that of King and Queen
>>540179691good chance we'll get some like Undertale mini remaster+full release Deltarune thing some day. as a truly finished deal.
>>540179410Because they spent a lot of money on this AI garbage and they want to get their money back, so the current plan is to appeal to the THINK OF THE CHILDREN ;_; lobbyist retards alongside cunts who want the internet to be a nanny state.
>>540179593sex is stored in them like squirrels hiding nuts in their cheeks
https://www.youtube.com/watch?v=hWC1NQqFuVwI just noticed he worked with Camellia here tooAre they besties now
>>540179691If Toby were to die today, we would probably hear about Undertale in 2095 when its copyright would expire
>>540179386Probably not until deltarune's 10th anniversary, which is in like, three years.If I had to guess he'll be using whatever he does on the 10th anniversary to announce the release dates on chapters 6/7, if chapter 5 releases in late 2026 like he said they would then it wouldn't be entirely out of the release schedule.
>>540176435what's wrong with that?
>>540179938Papyrus' fight in DR is gonna reference this as a leitmotif btw
>>540179691I will never not be mad.So much potential down the drain.
mr plap tenna tv splurt
>>540179593elderly crt so erotic...
>>540179867>>540179612Why haven't the think of the children groups done anything about the majority of American senators voted to cover up the Epstien list? You know the same day some Eceleb died.I can't watch porn with-out agreeing to provide the government a list of what porn I watch, but everyone who has litteraly raped children gets off free?
>>540180054
>>540178314I like Cockos Reaper as an inexpensive option, and I think there's a few good free ones but they're Linux only iirc so I can't tell you much about them. The only benefit of pirating FL Studio is the fuckton of VSTs and plugins they give you, if you're the most interested in that aspect then I'd say go ahead although it's very likely you're gonna have to look for additional plugins yourself since the ones that come with the program might not cover you for every case scenario.I only do song covers for myself when the mood strikes but I keep the trial version of FL Studio at hand in case there might be a plugin I can't pirate online or don't wanna bother installing anything new, I just export the parts I need with the sounds from FL Studio as WAV and then put the sound file in my main DAW and keep working from there. Although perhaps you shouldn't do that if you're serious about this whole making music thing.
>>540178667Honestly admirable how autisticly dedicated to his craft Papyrus can be.
I love pippins
>>540180310tenna would totally do that thing where they hold the tablet until it's almost touching their face and then use their single index finger to slowly slide across the apps, opening multiple adds every time his finger slips off and realizing too late how to close it
what's your favourite unpopular ship /utg/let it all out
>>540180553The Titanicsomeone help me I'm trapped in an air bubble down here my girlfriend wouldn't let me on the floating door its so cold
>>540176960this guy swam off the map and despawned>>540177435considering mettaton's unresolved body issues, he may be a virgin in every universe alphys probably scored at college
>>540180442Me too
so what are you guys having for dinnnnnnnnnnnnnnnner
>>540180772it's fucking hilarious that toby saying "ding" in the true lab is the closest he has ever gotten to saying Gaster's name
>>540180553
>>540178491who else but Susan "Violent Axe Susie" Gaster
>>540180772But it's only about to be 4PM... I can't have dinner yet
>>540180772I'm making slop for dinner because I'm too lazy to cook anything good
>>540179830Suselle but good???
>>540179070Yeah and also when he was talking about his Hand characters he made up as a kid, "hand" and "loki" (which indirectly inspired Sans and Papyrus) there was a third one named "ryo" that was like street fighter Ryu but then he says "but forget about that" Gaster shoots blasters / Ryu's hadokens lmao
>>540180553berdly and noellecarol and asgore
>>540180974what is your slop anon
>>540180772i don't know what i'll have for dinnnnnnnnnnnnnnnnnnnnnnnnnnner but i had a croissant stuffed with ham n cheese for lunnnnnnnnnnch>>540180863wow, they can be really cute when they're not having sex infront of kids or reminding you of how much toby fox hates asgore!
>>540180553Soriel
>>540180863this is way too good to be soriel ffs i hate toby fox and i hate his fans and i hate everything
>>540180553mettasans is cute>>540179830i'm surprised how much i like king and queen together. toby did good there
>>540180863they are so cute together and literally perfect the only people who dont like them are literal children and men who want to fuck their mom and feel cucked
>>540180553Carol and Dess.
>>540181013Tortillas with Mozzarella in them and cheezits as a sideI loveeee my slop
>>540180553papyrus and mad mewmewnot because anybody hates it but because i think nobody thinks it holds a candle of logic at times
>>540180772im going to binge eat
toby and temmie FUCKED
>>540180553Toriel and Rouxls
>>540180553Soriel, strictly by virtue of freeing up Asgore to date me. I want him to be happy and there is no outcome where she can give him that.
>>540180314I don't want to push this conversation for too long but really the best answer I can come up with are:People are stupid and the assholes in charge want more money and power. They are also stupid.
>>540181119I agree, people who have a problem with them seem to have a weird complex, usually sexually, around their mothers and this is coming from someone with a very bad relationship between my parents
>>540181476omocat and andrew fucked temmie by proxy
>>540181482i like how they both look unhappy
>>540180772I am going to make mashed potato quesadillas, I picked up the recipe from a korean youtube channel that makes all kinds of good looking shit.
>>540181482Hell yeah anon
>>540181708As they deserve!
Papyrus was right.This is the worst possible ending.
>>540181553basedreally hope he gets a happy ending in DR
>>540181878plapyrus
>>540180553Flowey/__Me
>>540181935anon he's public humiliation-flagged, it's been over since Ch1
>>540181326I find them both cute together. A prince and a princess. We don't see really any other club type card darkners so it's safe to assume she's a jack of clubs and the daughter to the locked up club king.
>>540180401fave says thanks for the advice
>>540179395
>>540182192Does Toby just fucking hate either his own dad or that Reid guy Asgore was based on?
>>540181947>*Minecraft skeleton damage rattle sounds*
I've been really busy so I missed the whole weekend charity anniversary event thing.Can I get the cliffnotes of what happened? Any thing interesting?
>>540182374Sometimes you abuse the characters you like the most
>>540182150What are you going to do, water him?
>>540182495People are hollow and bitter and angry they'll never be able to play a build made for a scripted event ment for entertaining a crowd.
>>540180553Idk how popular it is as a ship, but i've always liked that hidden chemistry between Sans and Alphys. It's intriguing how they keep their relationship a secret from everyone, even more now that Toby commented on it during the stream.
>>540182595''i'm a thirsty little flower...''
>>540182495You must imagine the stream you missed.
>>540182495All you need to know is there's a new browser-version Sans fight and that Gerson fucked human pussy before the war
>>540182495Just Toby cockblocks mostly
>>540182495Undertale is such an has been of a game it couldn't even raise half a million lmao
>>540182595No, but he can violate me instead
>>540182495Toby made a bunch of new stuff and than committed suicide of the author
>>540182495Nothing of substantial note.No new content for Undertale you can play.No new Deltarune content announced.
Sex>>540145185
>>540182495Baby Noelle was there
What did anon mean by this
>>540182836
>>540178314>>540180401Just pirate FL and buy it when you can. Reaper is a good piece of software, and the fact that its effectively free is great, but its rather barebones, opaque (for a beginner) and the tools for making digital music are usable but not that great for someone's first daw experience without a lot of tweaking. There is a decade plus of tutorials for FL Studio, a lot of very usable built in instruments, and a piano roll that is meant to be very easy and fast and expressive. It has quirks and pain points of its own but I think its really good for a beginner.Theres also furnacetracker, a free sequencer that emulates a wide variety of video game console soundchips, allowing you to mix and match them as well as load samples.Undertale Deltarune Noelle Susie Kris.
https://files.catbox.moe/siv0pb.mp4frightening new advancements in wiwi technology
>>540183052Real
>>540178330I sometimes kinda wish a hot girl did try to fuck me when I was a kid honestly. I don't think it's really pedophilic to say that, since I'd be the victim in that context.
In 20 years when Toby streams Deltarune on chapter 7s 5th anniversary, he is going to tell us how he stole most of the plot from HomestuckKris is Frisk's dancestorThe world itself is a game that works exactly like sburb.
>>540182613https://www.youtube.com/watch?v=lMoloUg8QpY
>>540179691I prefer Deltarune, so meh.
>>540178098>Noel suddenly loses interest in Stu once she realizes that he isn't that similar to Chess
>>540183416sorry for your loss
>>540183484>disco susie
>>540182785Now I'm imagining flowey/tenna abusive yaoi
did anyone post that video of the tenna cosplayer getting actually fucked by her fat boyfriend that was posted on Twitter yesterday im in public right now so I cant look it up but I just remembered. it wasnt very good (imo)
>>540183245He pretty much did. Beat-wise. Remember how Homestuck introduced concepts of grist, inventory, etc.? And then pretty much abandoned them? Mechanics in Deltarune have been pretty much abandoned, too. RIP Dojo, and item fusing. No more of that.
>>540179410I don't think they actually care about kids, if that was only it they'd fight the law. Tracking people will make them money somehow
>>540183742The fuck do you mean? The dojo is still being utilized.
Why is Toby literally incapable of creating even the bare minimum amount of content?What he can't open MS Word and write some more alarm clock shit? The fuck is his deal?
>>540183138I really like this
>>540183895the sans battle
>>5401837201. It was Spamton 2. Yes
>>540183720yes i saw, it wasn't great desu
>>540183939He had some drone make that for him.
>>540183894>still being utilized...I'll wait for you to get to Chapter 4.
>>540183720I couldn't jerk off to it because she kept making woman noises.
>>540183138They’re like bacteria
>>540183720Someone post this NOW
>>540182746It couldn't barely outpace the minor NPC in a demo. I think Spamton made more if you remove the money Toby dropped to kill Togore
if youre ugly and you put on a tenna paper bag that actually doesnt make you unugly it seeps through the mask
>>540183720>>540184240https://files.catbox.moe/c4e9cn.mp4
>>540184210Yeah, there's new dojo fights at the beginning of ch4. Elnina and Lanino have extra dialogue where they talk about Rouxls again.
>>540182374Who is Reid
>>540184142Elaborate
>>540183742But its funny right? It's hilarious that the one mechanical reward for pacifism is being shafted now right? Isnt it such a gut buster, you expected an encounter rush every chapter for getting all recruits and instead you got nothing and it was made a mockery of in front of you. Why arent you laughing?
>>540183720Are you telling me I could've had a mentally unwell Tenna simp GF this whole time.
>>540184420Shadow Legends our sponsor for the next thread
>hates women bodieswhy is /utg/ so gay
>>540175496Homestuck is great up to Cascade, then takes a trip downhill. And the stuff after the end is so awful I'd spend one of my three genie wishes removing it from existence.
>>540181763Link please, said Toriel
>>540184449the dude was fat and the girl didn't look or sound like she was liking it
>>540178472Its another guy named Toby Fox AI slop pulled from linkedin
>>540184402>Yeah, there's new dojo fights at the beginning of ch4>new dojo fights>fights>s
>>540184493Toby is, anyway. Your laughter is optional.
>no one posted the new thread>>540183137
>>540156926>/ll/Based and bluepilled
>>540184845You fucked up the bake. Didn't change the previous thread.
>>540184589Get comfy, Anon. And make sure to turn on subtitles.www.youtube.com/watch?v=PdYGXRXOPekReally almost all of this channel's potato recipes are excellent.
>(you)s, filenames, greentexts...>Every time the reply number increases, that feeling...>That's me.>"Anon".>Now.>Now, we have reached the absolute bump limit.>There is nothing left for us here.>Let us erase this pointless thread, and move on to the next.
>>540184994Bake it yourself next time, then.
>>540185173...now cue sleeping Kris and we'll be done here.
>>540183720the fact that the account that posts these has a robox pfp and proship dni in bio makes me have a hard time believing the person behind it is actually 22
>>540185173>DO NOT
>>540184370Damn you got me
>>540185837>No...?>Hmm...>How curious.
>>540186946admittedly sometimes i leave tabs of old threads open for like a week after they archive purely because i liked an exchange I had with someone and keep thinking about it
>>540187110>You must have misunderstood.>SINCE WHEN WERE YOU THE ONE IN CONTROL?>achives your thread
(Pretend the posts are seconds apart)
