Previous: >>546059606 >Character Trailer - "Nefer: Shadowbearing Serpent"https://youtu.be/jcFd1qbRg_I (EN)https://youtu.be/hDktaZmrzn4 (JP) >Character Teaser - "Nefer: An Inevitable Inconsistency"https://youtu.be/egKU8L59cCQ (EN)https://youtu.be/ohV402u_eGE (JP) >Character Anecdote - "The Gem Scam"https://youtu.be/46q9MNa50Yo >Miliastra Wonderland: Version "Luna II" Legendary Set Trailerhttps://youtu.be/nZA0vvO6EbU >Version "Luna II" "An Elegy For Faded Moonlight" Trailerhttps://youtu.be/w50jW_iEXns (EN)https://youtu.be/x-8hTneUDlY (JP) >5th Anniversary Theme Song: "The Long Way Home"https://youtu.be/OvHwco4OxDo >Current character banner: Nefer, Furina, Collei, Xingqiu, Yaoyao>Current weapon banner: Reliquary of Truth (Catalyst), Splendor of Tranquil Waters (Sword)https://www.hoyolab.com/article/41848209 >Daily check-in rewards (permanent)https://webstatic-sea.mihoyo.com/ys/event/signin-sea/index.html?act_id=e202102251931481&lang=en-us >Redeemable Codes with Primogems (all regions): https://genshin.mihoyo.com/en/giftGENSHINGIFT0FQBAJNXCUFUEPIC2025R4SCAU7CR1G9 >Useful Links (Wiki, Simulators, Maps, Character Builds, /gig/ friendlist, Third-Party Tools, etc.)https://rentry.org/giglinks /gig/ OP pastebin (use this if making new thread):https://pastebin.com/ca0zseQ9
For me it’s FocaFuri, NeuviFuri, ArleFuri, Furinde, Furivia, EscoFuri, Furiney, Furinette, WrioFuri, Chiorina, ChevFuri, Venrina, ZhongFuri, FuriEi, Furihida, Furivika, ScaraFuri, Furilali, FuTao, FuriMiko, FuriBina, Shenrina, Kaverina, Chirina and Skirina
Sex with Succubuzuki Sexzuki
We live in a world Where Chevy is a 4* and Emilie a 5*
>>546083890Jeets shouldn't be using this site
>>546084105Post Sparkle's feet to save the thread then
FISCHL! LADY OF UTTERMOST DARKNESS! A PRECIOUS TREASURE! A GODDESS SENT DOWN FROM THE HEAVENS ABOVE! A BEAUTIFUL MAIDEN IN LOVE!
GALE...BLADE!!!!
>>546083853Now THAT is some "pag" art if I've ever seen some
Is it holiday season yet?
>/gig/>standards
>>546084101Emilie can still become relevant after the Marechaussee faction rebalance
HUG TOW
Kokomi is cute
>>546084314>Marechaussee faction rebalance>Emiliekek
"Happy birthday, Kinich! I baked this cake for you... Try it, if you'd like!""Thanks – wait, hold still! ...I meant Ajaw. The cake's really good, Kachina. I'll make it up to you later...""Oh, no, no, that's not necessary! It's your birthday cake! Just hearing that you liked it is more than enough for me!"
Paimon is my cumsock.
>>546084352CUTEEEEE!!!
Wasn't Emilie based on some billionaire's irl daughter or something? It probably turned into an Aloy situation after her first banner and they're afraid to give her any spotlight, even for the most milquetoast interaction
Last year's was better
"Next time you sneak a bite, keep it a little quieter, will you?""Aaah! Let go, you petty little servant! Who even cares about these stupid fruits anyway!""Then you let go first.""Why are you picking on me alone?! We're the same kind, and I am the Almighty Dragonlord, K'uhul Ajaw! What harm is there in just one bite, you stingy wretch!"
>>546084101Deserved. Her hair color is so ugly.
Porkrinde: I'm sorry for being worse than:>Varesa, my greatest overlord who can deal more damage than my entire rotation with a single ass plunge.>Ineffa, who has 10 times more teams than me and has 10 times more usage rate.>Raiden Shogun, who is still better than me even at c0.>Kiryl Chudomirovich Flins, who mogs me in every single aspect.>The Princessin Fischl (Amy), who can apply more electro than me despite that being my main thing.>Ororon, who would still be a better unit than me even at lvl 0 simply because Scroll is more valuable than my entire kit.>KeKING, my biggest rival who is not only much less clunky than me but also much stronger than me once you get her to c6 for free.>Dori, who has more dialogue in a single encounter than i ever had in my entire existence.>Sethos, who is more relevant and more talked about than me just because he's a shitpost tool.>Razor, who appears multiple times in anecdotes while i haven't had a single one.>Lisa, who is leagues sexier than me with my censored design.>Sara, who somehow has more event appearances than me despite being one of the most forgotten characters.>Iansan the hero of Power, who is more meta than my c6 at c0.>Captain Beidou, who has a much more popular yuri ship than me.>General Mahamatra Cyno, who is a real left hand for his Archon, unlike me who never did anything for Furina or Neuvillette even though it's literally my job.>Kuki Shinobu, who can deal more damage than me burst with a single hyperboom.>Yae Miko, whose EEEQEEE feels much less clunky than my QEENANANAENANANAENANANA.
Please have sex with me...
>>546084528Why did they make her a psychopath who cleans up dead bodies then?
>>546084582Your mom should've swallowed that night
>>546084531
I love Skirk so much. I want to have sex with Skirk
>>546084372PAGGA DABBA DOO KINICH FUCKED KASHITNA TOO
>>546084780All of us are saying this
Columbina: Daisuki na Sandorone
What are we expecting from anemo from 6.3 onwards?
how much did this dude spend to get this score.
>>546084101She deserved better
>>546084582*burps*Aether.
why is scara in nod krai again?
>>546085017Have you tried not being gay
i had such a huge cuck boner when Columbina was talking to Dainsleiff and Sandrone
>>546084314Emilie was really good for basically all of natlan, pretty grim nowadays
>>546084352Why hasn't HE made an appearance in days after being here 24/7?
>>546085064Chiori is in the same spot, well C1 Chiori. C0 was never good.
OUR HEROES
>>546085047Just wait for it to be another "Aether"fest in the replies. That schizo is so predictable
Emilie is gorgeous
Happy birthday to my merchslut boy, I already know he's also getting that figure thing that Wrio, Kazuha and Hat Guy got...Speaking of which, is Durin a good pull for him?
>>546084780ooc btw
>>546085236I am saying this
>>546085236No one has ever said this
Durine is worst than Mavuika in literally every team and is going to flop miserably you all know this to be factual and true so why don't you FUCKING KYS YOURSELVES and never post again you aids ridden faggots?
>>546085212..and wanderer
How good is C1 Chiori + C2 Albedo?
>>546084972Varka is an air combo dps with anemo infusion who has busted multipliers above ground and meh normal ones but it requires skill to keep shit juggling in mid air (of course non humanoid bosses are fine) that's why he has to be played with Venti for his grouping burst
>>546085043Have you? Cuz if you did it's clearly not working.
>>546085021Getting his dollbussy rammed by Varka alongisde Fagether
Best Genshin to wife?
>>546085305Jahoda will carry the shotahomo banner, nobody can resist the 14 year old ukranian pussy with lunar swirl meta buffs.
>>546085236Everybody says this>>546085467Emilie
>>546085127Hospitalized
>>546085467Porkrinde is desperate for a husband
>>546085430How?
uh oh, aetherpag melty (spontaneous)
>>546085021claiming another harem
>>546085212Mostly soulful pic.
Post sandbina
Post sandpaper
>>546085305Who hurt you bwo?
>>546085305>>546085305/TRVTH NVKED THAT FREAK
>>546085682
>>546085550FVAAAAARK
>>546083853
>>546085440Aether would never let Wormka do shit unlike Troonderer
>>546085467
>>546085467For me it's Lauma and not particularly close. Only character where the shipping art gets to me just a little (Flins, not Nefer)
SASUKE BIRTHDAYhttps://www.youtube.com/watch?v=RexbBkmFWbU
>>546084780
>>546085212you can clearly see in this image that some character literally no personality.
>>546084356
>>546085816Post THAT Lauma
>>546085467Noelle (optimal housewife)Xiangling (chef) Yoimiya (mother material)Bonus: YaoYao once she's older
>>546085604scara's bussy gets claimed by sethos every night
The singular anti aether schizo is not enjoying this thread
>>546085909
>>546085236A couple people are saying this
It brings me great pleasure to know you suffer because what you believe to have been your game was stolen from you by incel gooners.
>>546085305I have no idea how good he is, and don't care for the design, but i am genuinely a gambling addict and just barely managing to hold myself back from rolling for the useless banners on this patch, so I'll be rolling
>>546084372Kachina is too powerful...
>>546085236Nobody is saying this
>>546085984Meant for. Pic unrelated>>546085671
>>546085305obliterated that durinpag freak
>>546085984>>546085987>glasses >blonde >medium size >black and white costume>Emilie is mysterious absent from everything has anyone seen Emilie and jahoda in the same room
>>546085305BASEDASED
>>546085236Several have said this
>>546085994>I'll roll of the trans pink hair faggot banner because [no reason at all]the worms have eaten your brains away you gay ass faggot
durin x manvuika team will be BiS till eos
>>546086184My sides. They really are like that
H's not even out yet by the way. The next 2 patches will feature him prominently in the Archon Quest.
Is this the first month we're overcapping on keys from imaginarium theatre? They've fallen behind in pace on releasing character echos, i've already unlocked every single one and am sitting on 4/4 keys even before claiming the 2 from this month.
>>546085236uglilie
>>546085909In a timeline where natlan and zzz never happened...
Bros a new McDonalds opened close to my houseIs there anything worth getting there or is it still dogshit
Literally fucking everyone: I'm skipping Durine
>>546085467noelle yoimiya citlali nahida xiangling navia collei hutaoin that order
I'm rolling Durin
I will accidentally pull Durine trying to get JawhoredaI can feel it in my bones
>>546086318Cope
>>546085236Cutemilie
>>546086348We all say this
>>546086403Roll on the rerun banner you fucking faggot what is wrong with you?
>View SameGooglelmgOpsSauceNAO 1718944171178.png, 313KiB, 1089x1019 Anonymous Thu 06 Nov 2025 00:59:51 No.545468084 ViewReport
Daisuki
Durin BROKE you
>>546085236
Durin WORMED you
>>546086510Wasn't it natlan (specifically mavuika)?
>>546086318straight men won, you lost
>>546086581it was troontaine
where is nahida to save this thread
>>546085236Does Emilie count as crossover character if she is perfume company director's daughter's self insert?
durin is straight btwbecause jahoda keep fucking him every single night
https://poal.me/7pp60chttps://poal.me/7pp60chttps://poal.me/7pp60chttps://poal.me/7pp60c
This is the worst part of coop. NA chat should be English only. I don't know what these fucks are trying to tell me half the time
>>546085305>Wormschizo is ESLmakes sense
>>546086510He's the ugliest character in the game.
>>546086616No, i'm pretty sure it was natlan who drove all the players away, i think you're misremembering something (or being dishonest).
>>546086642she's busy with Wanderer as usual
>>546086257What is 6.2 aq about anyway? Dottore?
>>546086705it's 2025 and you still don't know how to speak at least 5 languages?
>>546086705>Playing on mobileYou deserve it
>>546086761Wanderer is busy with Sethos as usual
>>546086705Skill issue
>>546086789Dottore will show up and get one-shot by Arlecchino
OH NONONONONONONONONO DURINGPAG (SINGULAR) WHAT IS THIS???
>>546086705>That Furina is probably strong>One person is missingThere you go
>Durine is worst thanYou're literally immune to knowledge m8 lmao
>>546086843It is a phone game brother. It is made to play while in bed or on the toilet.
>>546086318Usually the redesigns are complete shit but this one is actually adorable
The new sparkleposter tries too hard
>Durin is the ugliest character in this gameIt's not even fucking close
dbz posters have cucked us with /hsrg/...
Remember: Natlan saved the game after Fontaine almost killed it. No amount of seething about sexy female characters will change that fact.
>>546086653Why does /gig/ still believe this?
>>546087043I have a feeling a lot of power scale fags will invade the thread after the new story chapter
>>546086689>>546086935bros if you want to spam this poll so your side can win just open on a side browser, clear all cookies, and vote again.
yoi
>>546087013Exactly you can tell he's either falseflagging or just very stupid
>>546087043excellent, they should fuck off forever and never come back
i want to have anal sex with sigewinne
https://www.youtube.com/watch?v=rFtYzVJcWyA
>>546087058I'll have to correct you on that because pagtlan flopped more than anything else this game ever seen (factually proven)
>>546087043>posters >sIt’s one incel
>>546087043Good riddance
Uh oh the samepagging aetherfreak has woken up, get ready for another 16 hour of samepaging, while being the silent majority
according to every metric
>>546087208meluswines do not have anuses
>>546087237
You should all kill yourselfsEspecially loomtroons
We love Aether (better known as CHADther) here.
>>546087275...Natlan and Mavuika WON, manilatroon LOST
>>546087274based and intelligent post as ALWAYS sp00rkleGODDESS
marysuika flopped and slopped lol
>>546087279Cute blocky SiggyDo you have more like this?
This was a cool quest
>>546086319It's somehow shittier food now than it was 10 years ago, despite doubling in cost.
>>546087274>samepagingYou're pathetic anti aether schizo
>>546087406Uh oh durinpag GIGAMELTY
>>546087208everyone says this
>>546087338No. Neither does /hsrg/.
>>546086483Meant for >>545468084
>>546083853Whose property is this
>>546087408unfortunately no
>>546087338Agreed, and so does /hsrg/
>>546087338You have AIDS
>>546087406Oh no no no, he did not like this one. Nuh uh. Not ONE bit.
fuck off back to your general, grailerjeet
>>546087279I'll make one.
>>546087621*smooch*
>>546086318I really like this
>>546087621If aether and sparkle had sex they would create GIGA aids.
>>546085127>>>/a/283680806
>>546087409Post her gyat
>>546087785Cope
>>546087608>>546087506>>546087338https://files.catbox.moe/vdrevk.mp4https://files.catbox.moe/fj1jml.mp4
>>546087512>entire thread stopped to schadenfreude on the caeluspag>he started spamming pizza to derail the thread in an attempt to make it stopLMFAOIsn't it an interesting "coincidence" that it only happens on gacha generals that makes fun of a very specifically SEAnig self inserter, tho? That's crazy!
>>546087791So this anon lied to me?>>546085550
sparkle ruined this general.
https://soundcloud.com/ezeved/sets/4ck-songs
>>546086653Probably? It's not promoting directly though
>>546087409This raped pagtlans corpse basically, there's no possibility of redemption after.
>>546087905Post hand
Why do Mihoyo games attract so many schizos?
>>546085467The same one since 1.0: Lisa.
Aether: i had sex with durin and i liked it
>>546087905https://files.catbox.moe/kcoz62.mp4
>>546088049omnipandering
>>546086935=Durinepags lost so fucking hard lmfaoooooI don't think we should ever let them post in our general ever again
>>546088047Post hand
>>546088163Concession accepted
>>546088049coof+omnipandering brought in the worst from every group
>>546088201Yeah i received yours.Thanks, come back soon.
>>546088327You lost
>>546088049Fatherless LGBT white & brown failures and self-loathing children of immigrants who desperately want Genshin to be their safe space despite evidence to the contrary.
>>546086318Cute
>>546088049Genshin being a omnipanderingCHADgame pisses of all the schizos who wished it pandered to them specifically instead of everyone. They don't realize this game wouldn't have become this big if it wasn't one.
guys when does genshin get good?
i'm sorry for being a retarded schizo...
>>5460885131.0
>>546088368Post hand
>>546088513inazuma
>>546088049Not banned in SEA.
>>546088540Im brown sorry
>>546088530Antiaethertard...
>>546088530Aether pag...
Nahida please save this thread
>>546088530ACK...
>>546088530We know samepagging aetherpag
>>546087621Thats the most ugliest face that ive ever seen in hoyo games
There's nothing wrong with being brown.
>>546088614she's busy
Can I like Furina
>>546088530jamalther...
>>546088695>t.grailerjeetpag
White is right btw.
>>546088513If you just started, when you get the prompt to head to the next region (Liyue) make sure you take the route through the big mountain. This stopped me from uninstalling the game
>>546088601>>546088657>>546088743Subtle. Organic. Nuanced. Delicate. Understated. Subdued. Faint. Refined. Elusive. Slight. Implicit. Indirect. Insinuated. Suggestive. Oblique. Discreet. Muted. Soft. Gradual. Sly. Disguised. Cryptic. Intricate. Perceptive. Finessed. Ambiguous. Ethereal. Minute. Barely-there. Implied. Natural. Biological. Living. Ecological. Botanical. Untreated. Unprocessed. Whole. Pure. Authentic. Genuine. Native. Homegrown. Wild. Raw. Wholesome. Sustainable. Renewable. Green. Earthy. Unrefined. Handcrafted. Artisanal. Intrinsic. Innate. Spontaneous. Organismic. Physiological. Naturalistic. Holistic. Non-synthetic. Non-artificial. Unadulterated.
i'm brown but i only date white guys
Is this his playable segment?
>>546088667
>>546088809Porkrinde........
>i am honorary white
>>546088827UID!?!?!?!??!?!?!?!?!
You will never be white and you will never get a tall white Scandinavian lover, Nur Fatimah!
>>546088809don't krai aetherpag...
Bina feet is the best thing to grace Grenshin Impact btw
Go to sleep.
>>546088885It's just funny how you accuse others of samefagging when all your posts sound the same every time
>>546088901Why does she have water balloons on her feet though?
We love Sparkle here, she's /gig/core and it was a big mistake by HOYO to not have released her in Genshin.
>>546088901Nahida's feet...Nilou's feet...Columbina's feet...Focalors' feet...
>>546088695Or so you tell yourself aetherpag...
>>546088974so she can stuff it in my mouth while she teases her toes on my lips
>>546088994Post hand
>>546088809Uh oh aetherpag melty! He's gonna start accusing everyone of being a singular person again, then proceed to reply to his own post with "xhey didn't like this" and "bodied that troon" over and over. He really thought he was smart..
>wormschizo aetherpag copies and repurposes previous shitposts directed at himAbsolutely soulless.
>>546087535she is your proprietor
>>546089053It really is that easy to recognize him kek
>>546084528You can have an interaction with her in Curatorium idk if it's Nefer-locked or not.
>>546088695True, but it is wrong to be from SEA
>>546088938>schizoramblingShh... No tears... No more tears...
I'm brown but i only date white girls
stop posting sparkle. she makes me sad because i will never be a cute girl like her
>>546089140iansan...
>>546089140BAAAAAAAAAAAAAAAAASED
>>546089053That's literally what the replies under anti-Aether posts sound like. You're not smart enough to make others look bad because you always end up projecting, sparkletroon>>546089058You're probably talking about this >>546089089 guy who literally just called out for being recognizable
>>546088984TRVKE
[Fact]Mondstadt is so fucking bad that most players uninstall before Liyue>>546088783
Imagine having pagpag dinner dates. Wouldn't want to be aether's wife.
>>546088575sea is hoyo target audience though
whoever is brown and is dating a white GIRL, is a based CHAD.
Tell me, is "anti-aether schizo" in the room right now? Or did you invent him 2 weeks ago to cope with the fact you have been relentlessly bullied by yuritards ever since nod krai started. Wait i don't have to guess.
>>546089253See>>546089045>>546088047>>546088163
>>546089217This guy is becoming ACK 2.0 and its hilarious.
>>546089113TRUKE the only sanctioned brown is the Yookay Strain from Birmingham and the Burger Strain from New York & Minnesota!
>>546089058Well, plagiarism is the way of the incapable.
I'm brown and as early as 6th grade some white girl wanted to see my dick. My grandmama always told me to be careful with those white Succubus's
im white
You are a single person, anti-aetherschizo.
>multiple acksWhat did /gig/ do to deserve this?
>>546089352Obviously meant for this schizo >>546089053
>>546089053>>546089319based post as ALWAYS sp00rkleGODDESS
>>546089428white males aren't worth much though
KWAB
[Factual] We all hate Durine here/TRVTH NVKEM
>>546089253Post THAT pasta.
uh ow
And the winner is
Durin is so cool....
If Aino asks Ineffa to draw her a picture, is it an AI picture?
4chan is just twitter nowadaysA poop festival
>>546089349I've already posted my hand and passport months ago. And you coped with>he's brown!>he's brown with a kiwi passport!>w-well you finally posted your hand but what's so good about being white anyways?In that order.
>>546089636No one says this.
Durin is ok
>>546088667Chasca....
>>546089631Flins: Aether, you won my heart. I am going to stay by your side forever. Im gonna blow you btw.
yurihomocordwormsJeetsPAGGA DABBA DOOFVAAAAARKTRVTH NVKEDzzzSchizoDurinpagbikepagtlanmeltyackpanderingself insertaidssloppedtroonsincelmindbrokenniglangooner
Krai: I always knew I was a Nod
this thread is really bad
>>546089684Why are you pretending to be me? I was the one who posted that and I never engaged with your MC war nonsense from either side. Keep me out of this
>>546089739Thanks for saving the game after pagtlan flopping, Nod.
>>546089783leak drought it is what it is
It's a date, Sandrone.
>>546085467Aether
The only way whites can feel special, desperately climbing the victim pyramid, is to declare yourselves as genetic and mental mutants.You are not special because you like the opposite genderYou are not special because you chop off your own dickYou are an attention seeker, in despair because your society now views you as a punching bag ethnicityGenshin Impact
Flopstra Flopderland killed Genshin
>>546089821Bina...
Now SCRAM, aetherpaggot. Your worms have gotten lose, better screw them back in.
>>546089393The plural is "succubi"
My favorite ship is Focacchino
>>546089909We already have enough schizos, we don't need another one
Stop talking about race.Say something about Kazuha instead.
Sparkle would never say thatShe would indeed talk like a 12 years old tho
>>5460899711000 /gig/ers served
>>546089926It literally saved the patch because no one is pulling nefer
>>546089818There is nothing left to leak. Maybe in 2 weeks we'll have line count.
>>546090053Bro you have no idea where that mouth has been
>>546089971BAAAAAASED POST AS ALWAYS SP00RKLEGODDESS
>>546090164He likes to watch, and taste.
>>546090053You just got AIDS from sparkle
I jack off to every single Sparkle post.
>>546090164My dick only
What was his problem?
>>546090387Many are saying this!
>>546090450frustrated sexuality.
>>546090486That it was Aether's dick only? Correct
gig : it's a date durin
a doujin of them having a babymaking sex will save me
I love Skirk so much its unreal. I want to have sex with Skirk.
>>546090526Can you stop thinking about gayther's dick for a second
>that it was aether's dick only
>>546090637When you stop spamming your gay fantasies about him
Aether: it's a date, Durin
>>546090634
>>546090637No he can't...
good night bwos
She's sleeping, don't wake her up
You're just mad because Aether's cock actually gets to be in a pussy while you probably wish you didn't have yours
>>546090845KEEEEEKARO
gig : we all fucking hate durin to the core
Spare change?
>>546090634I regret skipping Skirk. Hopefully she reruns with Escoffier soon
>>546090931/TRVTH NVKE
>>546090845Interesting how spamming an AIslopped wall of text is fine but you always feel the need to call out someone posting AI self insert art
Meanwhile, in bizzaro /gig/
>>546090450Did no one remember el doctoro real name?
Are you hyped for better Animal Crossing?
>>546091087I LOVE AETHER
>>546090931BODIED THAT FREAK
>>546091087We hate durin here
>>546091076No one draws aether because everyone hates that faggot and it's self inserters, anything else?
>>546090845KEKYDOODLYPOW
>>546091087Hydro Traveler is so strong, Why couldn't Neuvillette's shit kit be like this?
>>546091221You sound upset.
>>546090931Everyone say this
>>546091087this harem game really panders only to its target audience of thai "men" who self-insert as Aether and only pull female characters!
>>546091282Aethers design is upsetting.
>>546090931No lie detected
>>546091087Genshin peaked during Natlan.
>>546091371Your diagnosis is that you're a massive larping faggot. Anything else?
What happened to /gig/ and why is it mostly shitposters?
wormers on suicide watch lmao
I just haven't been the same since I realized I cum in my sleep after getting "bullied" on /gig/
>>546091406But enough about aetherpags.
>>546091389>The broken coffee machine I threw in the trash found a new home
>>546091421because you didn't pick up the torch
>>546091389holy c&c
>>546091087i HATE everyone
>>546090931faggots are killing themselves worldwide at this trvke
>>546091536Concession accepted you literal homo
>>546091529jamalther...
The man who broke /gig/
>>546091169Why did they theme their Pokemon killer with Honkai but they didn't theme their Animal Crossing killer with Genshin?Is that subtle admission that they are ashamed of Genshin as a marketable property?
Escoffier: I lo
>>546091648You wish
>>546091727ve pussy and female breasts
AItherpag: I pay $10 (166,903 Indonesian rupiahs) every month to generate AI images of Aether with female characters since no one wants to draw my faggot manlet
>>546091087How's hoyo gonna design a SO cycle that's impossible for dehya to brute force, her kit's so overturned it's ridiculous.
just say you hate duin you fucking fencesitters
>>546091767KEKAROOOOOOOO
>>546091734Aether broke you, fag
Medium height males shouldn't exist
>>546091727ve Wriothesley
>>546091795Not your personal army, aetherpag.
>>546091767I didn't even know what the currency in Indonesia was called. You're not beating the self hating pay allegations
>Almighty Dragonlord>he's actually one of the Thirteen Sovereign DragonlordsYou rike? It hiding in plain sight and not onry schizophrenia.
>>546091918google is a publicly available tool
>>546091918Post hand.
>>546092002You're not fooling anyone pag
>>546091910kys wormer
i fucked up my post and i'm gonna kill myself
>>546091734BODIED THAT FREAK
I wish there was a function like in Fortnite where you can hide certain characters you own. I don't want characters like Thoma or Sara or Sayu or Yun Jin or Tighnari or Collei to be shown.
Aether's micropenis...
>>546092018>posted it again awardEveryone can see through your faggotry>>546092023Sorry but when you're making posts like this >>546091767 you better have a pic of your hand attached or people are gonna make reasonable assumptions
>>546091949
>>546092002Not on his dictatorship.
>>546091949>>546092104>>546092172
>gaythercel melting down againsmfh and then they had the nerve calling us (real straight males) gay/trannies or whatever for pointing out his obsession with gayther and his micro dick 24/7 everytime someone post a waifu
Fontaine's legacy
Aether would have been better as a shota but gay pedos would have ruined him instead of making him a straight shota icon
>I'm gonna post gay pedo art to own the chudsWhat is wrong with anti aether schizo
Now this is a good thread.
>>546092153Cool story bro now post hand.
Looks like the gays and women are here
I like durin, i will roll for durin. I think he is cool and looks like a vampire boy (which is cool), i think he has aura, i think he is stylish and has class, i think he is probably going to be a good meta support. I like his lore. He appeals to cool thing enjoyers such as myself, i am a straight man with a average sized penis.
>>546092153We know aetherpag(singular) (ack 2.0)
>>546092270Kek guess these posts>>546088047>>546088163>>546088540>>546089045really triggered your PAGGOT ass didn't they. Sorry you can't escape that place, xis.
>>546092353I see, interesting. Now post hand.
>>546092310FVARK... the ENJOYER.. I kneel
>shota porn
uh oh, wormschizoschizo melty!
>>546092267>shat himself so hard over aether he can't even think of something else to sayI broke you your tiny faggot ass
>>546092310Same, but I also want to fuck him in his bussy
>>546092420Look at how she straightens up her posture before the hug. She's hugging someone who is slightly taller than her.
Good morning best hours
>>546092526She's hugging Arle
>>546092510that looks kinda fun
This melty is gross and pathetic jesusYou will always be on the wrong side of things no matter how much you delude yourself
Aether: it's a date durin>6 hours laterAether: wow that was intense...
>>546091087Look like calorinde won again damn
>>546092353Your hand. Post it.
>>546092670kek
Duin: i'M dying of herpews
>herpewslol
Great now the ban evading dbz greentexting spammer woke up
Might have to leaveThe lgbt levels are getting too high in this thread
>>546092775But enough about you pleasuring yourself while being buckbroken.
Aetherpag: Why does everyone hate me?
>>546092959You finally came up with a different sentence after 30 minutes, too bad it only applies to your faggot kind lmfao
>>546092930KEKYKWAB, they really look like this
>>546092995Because you're cringe... And is a literal pedophile that spams pizza...
Why is it always Gaether? Why we never get lesbian Loom spam?
Is Dehya gay?
>>546092995You're not everyone pag>>546093095That's the anti aether schizo.>>546093105Canon princess isn't as important
everyone hates durin no matter how much you samefag your life way from reality
>Great now the ban evading dbz greentexting spammer woke up
>>546093121Yes.
Aether canonically loves Xiao.
>>546093105Cause people like seeing LumineIf you post naked loom licking a pussy or sucking a tit, that's rewarding the threadIf you post naked aether, you're punishing the thread
Why is /gig/ like this? I think I'm seriously done with this shithole. 0 absolutely ZERO discussion about the game. This is beyond ridiculous.
>>546093121I think it's undeniable Dehya likes girls. She's just like me fr fr
>>546093220Good to see you crawl back to the only answer that makes you feel safe lmao. You will never be able to have a real argument because of your intellectual disabilities.
>>546084081i want this twink destroyed
>>546093282There's LITERALLY nothing to discuss.
>>546092526She's hugging Flins!
>your life way from realityYou're literally immune to knowledge m8 lmao
I prefer hetero Lumine spam.
Buckbroke the dbz spammer too without even trying
>>546093370cute way to admit you are dying of AIDS faggot
Daisuki na Aether
Futa Loom
>>546093575no one says this
>>546093494KEK got that stupid sparkletroon.
>the so-called "straight" aetherpags are melting down again and posting gayporn of his favorite twink in retaliation im so tired of SEA and South Asiarangeban when?
>>546093575Xiao said this
>>546091087Just picked up a torch
>>546093105Aether is disgusting much like his self inserters.
>>546093589Big or small futa?
>It's another raid and are currently reveling in making everyone here miserable by shitting up this thread
>>546093494Seething!
>>546093613don't worry I know she's never recover from my trvke
>>546093720You literally got btfo'd and you're still trying lol get over it faggot
>>546093282What do you want to discuss then?
They should've never made Aether playable
>>546093575We know Flins
>>546093347Ok this is insanely cute. I hope something like this happens in-game because I want Columbina to feel happy and loved
>>546093856You sound a bit irked (a lot).
>>546093873>Aether game>without AetherYou're simply not a Genshin Impact player then.
Aether was a mistake
>>546093979annihilated that faggot
>>546093121sex with emiru cosplaying as dehya
>>546093979Sent that cow flying
>>546093979Don't forget his sethos x scara stash.
>>546093979Sparklefag is on fire today holy
>>546093873Primordial truth here. Biggest mistake of genshin, cost them billions.
>>546083853Ah clanker don't hate me cause I'm beautiful clanker. Maybe if you got rid of that old yee-yee ass haircut, you'd get some moon bitches on yo futa dick. CLANKERRRR
>>546094021Faggots like you are inherently irking
>omnipandering game>protag only appeals to fujos????
>>546093857>>546093857Literally anything related to the game. Even /hsrg/ is actually on-topic for most of its threads. All this general does is genderwars and salesposting, and any actual discussion related to Genshin either gets ignored or devolves into the same recycled schizo nonsense. There's a reason why jannies gave up trying to moderate this place, trying to get rid of off-topic shitposting would get rid of 80% of the posts in this general. Legitimately I'm starting to check this general less and less because of this shit, it's fucking grating and everyone contributing to it should cut open their stomachs and hang themselves with their intestines Genshin Impact
Never let women cook again
um does anyone want to talk about tcg??
>>546094048Your parents are saying this about you
>>546094227/hsrg/ has as much genderwars and salesposting if not more
Happy Birthday to Kinich
>>546094276Aoi Yuuki is so beautiful
>don't worry I know she's never recover from my trvke
>>546094296It's done by the same people btw. i see similiar posting styles in both generals
>>546094308Who?
Do I crown Lauma's skill or burst if I am only letting her have 1 crown for now?
>>546094296No the fuck it does not you disingenuous faggot I just looked through the entirety of the latest thread there a majority of it is actual discussion. Kill yourself
>>546093979Sent that cow flying!
>>546094175No one cares about the mc
>>546094227>>546093282These posts could've been (You) discussing the game instead of complaining about /gig/ not discussing the game, you know. Now, what on-topic subject are you here to discuss?
>>546094435Skill, but she really wants both
>>546093979Put me in the screenshot
It really wants me to acknowledge that post doesn't it? Take these crumbles you obsessed samepag
>>546094435Crown her skill. It gives you more elemental RES decrease
Aether: just slipped my cock inside durin's bussy
My hands smell of bleach
>>546093979Holy STRVKLE
Is this ack?
>gay sex out of nowhere>again It's all so tiring
For me, it's Kinither.
>>546094450No retard I regularly visit both generals and /hsrg/ has the same genderwars and the same old region vs new region shitIt also has as much salesposting with the same talk about tiktok hours and shitThe only thing /hsrg/ doesn't have is the DBZ spam
>>546093979Holy KEK
>>546093979KEKKK
I love little girls so much
I live rent free inside every /gig/ger's head
>>546094914Kachina’s dads
What's the easiest Nod-krai local legend to get the frame
>>546095021I think you need 7 or 8 out of the 9 achievements so you're going to have to do them all anyway
>>546094998
>>546095021>>546095072Can you get these from like a WL3 or something
>>546094981Bike...
>>546095021Raskolnikov is a skill check and Crab is a dps check so whatever suits youSigurd is both
>>546095021Ask some whale in here to come and nuke them for you
>>546094981The concept of raping Sparkle...
>>546095148They specifically made it require world level 8 or 9 (forgot which one) probably because people were cheesing some of the Natlan local legend achievements by visiting low world level players' worlds
>>546094981The better game Wuthering Waves...
I blame Nod Krai for shoving in all the yuri and making him lose his mind
>>546095224Kek what a bunch of fags. People already aren't bothering with achievements and this is what they come up with
>>546094981Mizuki's butthole...
the sandbina hug will save or destroy /gig/
Uh I think a brown recluse might've just bitten me...
>>546095336Sorry this one just sound like a self own
>>546094012Same, Flins is such a loving man it would be amazing for her.
>>546094981The complete Kokomi domination of /gig/ in 2022... The fall of Dijon Mustard...
>>546095382It will save /gig/ by filtering the undesirables
>>546095382>lesbo hug>durin on banner Yeah, have fun guys.
>>546095440are they on hrt?
>>546095287It's true that the yuripag lost his mind and lowered the thread's quality, but you can't blame it on the devs since there's no yuri baiting
>>546095476Based
Does Miliastra Stupidland at least come with the minigames from past events?
>>546095570No
Oh yeah forgot to mention No one will agree with you no matter how much you samepag using THAT site.
>>546095506They are from Genshin. They're not HRT chars
uh oh spork meltie
>>546093979Insane how the sparkleposter always gets supressed for speaking the truth
Sparklefag outing himself to let everyone know how he's ban evading
>>546095021You can cheese Sigurd with a solo Anemo Loom.
Yeah im thinking the aetherpag got squished today
Lauma is so lucky
Can you all post Yoimiyas instead?
>>546095896>>546095916KEKADOODLEDOOOOOOO
Lauma would've been my favorite hag if it wasn't for her Chasca faceShe comes close though
Aetherpag (singular) did not like being called out huh
This thread sucks im gonna play fortnite
>>546095570what are you like 5 years old
please stop bullying himthis is just sad to watch
Can they stop making slightly difficult weekly bosses? The drooling retards in co op can't handle them
>>546096123C&C
You're too autistic to bully anyone don't be delusional
>>546096123Cute
Look at what you did you idiots. You killed our public toilet.
I love Furina
>>546096205Alice?
>don't worry I know she's never recover from my trvke>You will always be on the wrong side of things no matter how much you delude yourself
>every time kek
To be a bride
Our goddamn Germanic heroes…
>>546094141I would've chosen Lumine if she was cuter like the Stella Sora main girl.
All of /gig/: I fuarking want to see SKINvillette
>>546096494everyone is saying this
Aether: i love flins, kinich, lyney, xiao, durin and childe from the bottom of my heart. What? Who says i can't have multiple husbands? Teyvat has its own laws.
>>546094152>BEEPBzzzt, Clanker is our word. You can say "Clanka".>BOOP
when did xzr become a yuri truther
>>546096594He’s spent the last 3 years trying to make Shenhe and Yelan a thing
>>546096594If you weren't blind you'd notice that he's always been a yurifag. He basically created the Shenhe/Yelan ship
new sandbina
>>546096205That's the fun part though.Although Natlan's boss is retarded in how it actually deals damage to your characters. Less of that bullshit please.
messed with the big dogscouldn't handle the pain
meanwhile NA miliastra
>>546096123Is this from the event?
navia hate
>>546096936Yeah having to reset 20 times because some retards keep dying when you just want to farm some friendship xp is exhilarating
>>546096674Why does the EN community have no creativity? Why does the UGC look so choppy, this is a multi billion dollar company?
>>546095972Pov your freminet
>>546097038mihoyo fears the ragdolling
>>546085305After half a decade, retards still use this argument.Even in the 1.x days, people kept saying retarded shit like this><some far off buffer> will be worse than B><some far off support> will be worse than X>etcwhen it didn't matter because Abyss still required two teams, and one Bennett + one slightly worse Bennett still means you can field two teams. OH NO, with Xingqui and Yelan I have too many hydro support applicators! Said no one ever.This is even more relevant now with both Abyss and IT and Stygian potentially wanting to field two Mavs or Mav replacements. For instance, with Durin I can field a cow overload team and a normal Mav team in one run.
>>546096594Xinzoruo has a Bang Dream alt which is literally full of yuri art
>>546096674What the fuark
Imagine meeting Columbina in her beautiful dwelling but instead of seeing cute Lumine on the screen, you're playing as a faggot twink with his ugly belly button showing. I think being forced to see this fag on the screen all the time would drive anybody crazy.
>>546097023That means you are losing too dummy, if you and your character was good enough you could still win.Maybe just accept not getting the x2 friendship multiplier for your few weekly boss runs.
>>546091087We love filipino cuisine here.
Here's your 6.3 map expansion
Sigh...
>>546097309Content bros... not a good look
>>546097328Same… I didn’t get nefer weapon. Whatever
>>546097328>drained your primos for a brick bannerOh know
>>546097309I hate water.
>>546097179Yeah my Citlali is going to to crush that shit. I HAVE to go damage or else the retards can't fulfill their roles.It's just a failed raid boss concept move on.
>>546097337Cute
Flins is for aether...
/hsrg/ currently has more Genshin discussion than us
>>546097703Honkai star rail isn’t a game every game mode can be beaten by autobattle It’s just a character building sim
>>546096205I stopped playing coop for thatGosoythoth is annoying without Natlan charactersMondstadt chess one just hits too hard and specifically needs freezeLike I stopped playing coop since 5.6But I decided to give it a try in Arlecchino's boss and the team was Nefer/Flins/Furina/Arlecchino only for thr furina to literally not use her damage skill aka no hydro application for Nefer and Flins to do damage. We kept screaming at her to change skill but nothing worked.
>>546097309Is that the smallest map expansion to date?
>>546097831Your baizhu house?
>>5460975721. Citlali's last banner was ages ago, she should be max friendship purely on commissions2. Don't enter co-op with passive characters like Citlali you retard. You don't even help your teammates with a shield unless you are C2+.
Hey I don't usually post here but I have a complaint to make. When the character you spent years leveling up, and your team you spent leveling up, loses to the Knave it's bullshit . You literally spend the game doing crazy shit and pulling off things that are punching down at you, and then Mihoyo insults you by forcing you to lose in a cutscene with a shitty entry level weapon. They didn't even do a Sekiro and have it acknowledge your skill before pulling a canon saving deus ex machina, they didn't do a devil May cry thing and end the story with the credits rolling saying you whooped everyone's ass so there's no more story. They just slap you in the face, and then expect you to just keep playing. I stopped a while ago, but looking at that story just made me absolutely never want to go back.
6.3 map
>>546098027
>Lauma and Nefer >Wyrmin>Sandrone and Bina hugging>Flins being the only one sucking MCs dickThis is no straight man region you lied to me
I love playing with my little dick
I double crowned her and Lauma but I need more elixirs so I can craft more artifacts…
>>546098027Those arrogant fools
>Nobody will care about the size/extension of the map when Dottore appears on the sceneremember this
>>546098348xingqiu......................
Klee WONNo more attack cancel autism https://x.com/MeowTews/status/1988080481963811304https://x.com/heffil0/status/1988096258372927912
I lauf whenever people post laufer.
>ventixisters....
>>546097642>Flins is for aether...He will devour Aether
>>546098592>they're actually going to nerf their ancient character buffsjeez, no fun allowed with these devs
Please come out as hebe type, tsaritsa.
>>546098845I hope she’s hag just to spite you
>>546098929>Yae Miko, whose EEEQEEE feels much less clunkylies
>>546098431Is this enough to make her better than Raiden
ugh, boring! isn’t there anything better to schizopost about?
Poopeena.
>>546098431Is it an actual change or they just removed cd with command?
im worried they're going to nerf fell dragon into the ground like jeht
they should should make a genshim that presses qqqeqqq
>>546099126That's not a high bar >>546099325Actual change. Was part of her buffs, none of the beta testers have shown footage of klee until now
Eula buffs... the KoF faction...
>>546099415Looks good then, glad i got c1 Klee. I think she will be pretty OP with buffed Fischl
>arle gets powercrept by kleeShe’s turning into the new Raiden sunk cost brick meme
>>546098431She reversecrept Hu Tow and Arlecchino
>decide to boot up HSR since its been a while>get bombarded non-stop on login with Mihoyo's shitty pink elf that they shill non-stop from HI3She better never come to Genshin
>>546099559wait for when Klee receives signature 5*
You're all a bunch of fags
I just realized they gave Varesa, a catalyst user, a melee CA...that you'll never use because it's suboptimal.
It’s Tataco TuesdayPost Kachina
>>546099343This is citlali combo if you're a sissy faggot who use her stupid r1 instead of ttds like what straight men did
>>546099674i like it when u talk 2 me like that *sucks ur cock*
>>546098896I'm sorry I keep writing this. I was anxious and wanted to appeal to someone. I'm so sorry.
>>546099694I love Kachina so much
Soon
>>546099679it's useful the jump when you gotta hit the pillars summoned by that natlan robot or when you fuck up your timings and run out of E charges
Why are we dead
>>546099679I use it to break ores.
>>546099679At least its ONLY suboptimal when you gotta use it.Try having a catalyst charge attack like Citlali's, I cannot find a single use case for it with its cast time, stamina drain, and utterly worthless damage. Yes she is support, but so is Barbara and if you really felt like attacking with Barbara's charge attack you could.
>>546099928We're sleeping
>>546099928im eating pizza :) (imagine i posted fat raiden)
>>546100038Which genshin?
>>546099928Janny is anti-fun and killed all the funny posters.
There are a lot of pictures of Aether's romance with women here. But has Aether ever had such an atmosphere with characters like furina and lauma?
Arlecchino: i'm sorry for being weaker than a literal toddler and going down the pyro DPS ranking from 2nd to 4th in a single patch.
Dendro is the best elementYay dendro
>>546095148You can ask a whale to help you and do them in co-op. You both still have to dodge Sigurd but it'll take less time if you have more dps.
>>546100120its ok at least you arent tartaglia or capitano
>>546100120You know that she's weakened because she had to rescue traveler and koronbina from that abyss domain thing right?
>>546100112There are more pictures of Aether's romance with men here actually
>>546100112Yes
>>546100156everyone is saying this
Genshin for this feel?
>>546100156
>>546100323Yuripags and Columbina
>>546100323Eula and Lawarchurl
>>546100323Aether.
>>546100120>2nd to 4th in a single patch.She was already worse than Lyney, Diluc, Hu Tao, Gaming, Mavuika.
>>5461001205* characters from before Natlan not being explicitly buffed are no longer allowed to be useful. except they fucked up and Nahida got improved by her own powercreep while Nilou is useful again
>>546100323Aether and any female Genshin
>>546100038Ai has rotten my brain so much that I start instantly lookng for a sora watermark for these kinds of videos now even if they're real
>>546100371>>546100382Keep seething, this is a harem game. The girls CRAVE Aether's presence, whether you like it or not
Wrio is still shit but at last his best team is full male now
the boys crave aether too
Is it mavuika that Natlan failed?
>>546100453Based, based, BASED
>>546100507Mavuika failed Natlan
>>546100505That would have nothing to do with him anyway
Craving Venti's hole
Every hebe that exists: We love AetherSimple trVke>but homo twinks say it tooThose lines are crumbs for loom players
>>546100505More like only the boys crave Aether.
i wish he posted nice images of aether
>>546100505more like Aether craves the boys
>>546100495All males in this games are worms except Aether
im bored
>>546085807Aether has tiny, girlish hands
Aether: i let durin put his worms inside me, i hope i boypregnant.
>>546100690wanna make out
>>546100586this post is 100% trve but the local copers will deny it
>>546100654especially Aether* since he sleeps with so many of them
>>546097703I'm on and off in star rail. I needed help a couple of times after returning and received genuine answers one single time exactly the rest of the times I either got ignored or got shitpost replies.They mostly discuss shipping, thread personalities and have same schizo/saletards raids as we do.
my niece said that i look like aether
>>546100586>but homo twinks say it tooIt's like their admitting all their beloved male characters are nothing but a bunch of worms lmao
Every tall male that exists: We love Aether
>>546097703Because /gig/ has decided to house all the schizos and /zzz/ is just dead because the game is dead so that leaves /hsrg/ with at least players who give a shit about the game and its lore. If we collectively ignored schizos our threads would improve too
https://poal.me/8hjzomhttps://poal.me/8hjzomhttps://poal.me/8hjzom
>>546100392Why is Nahida staring into my soul
which girl takes the biggest shits
Aether
>>546100910
Furina: I love AetherNilou: Please dick me down AetherCitlali: Aether come over to my houseAyaka: Will you marry me Aether?
>>546091051My Skirk is C0R1 but I really want to get cons on her next banner. C2 would be nice, since it would make her a more viable burst dps.
>>546100323Chief pacal and kachina
>>546100910She just blanked out thinking about her favorite Akademiya student
Every man and woman in Genshin and all male and female players of Genshin: we love Aether
>>546101123This makes the anti aether schizo (I refuse to believe it's more than one person) seethe
lumine: i sucked dainsleif off but i was thinking of aether the whole time
anon: im so fucking retarded and gay
>>546101278Dain fucking wishes
>>546100910She knows what you wantbeing given a headpat
UOOOOOOOOOOH KLEE-CHAN YOU ARE SO CUTE AND META *KISSES HER KIDDY TUMMY* I'LL GIVE YOU MORE CONSTELLATIONS MY DEAR
>>546101381kek bodied me
>>546100887/zzz/ looks plenty alive to me, it literally has two simultaneous generals
I still sleep with my niece
Anyone wanna body me?
>>546101549*body you*
>>546101549*bodies you*
>>546101498Aether said this.
>>546100120At least she's the 2nd, no 3rd actually 4th strongest Pyro dps.
>>546101549freak
>>546101590forgot your pic Varesafagalso forgot your torch on the ground
>>546101548Nieceanon your lore is getting goncerning
You’re no self inserter, you’re making a mockery of them no self inserter runs around speaking another mans name 24/7 instead of imagining themselves with the waifu. You’re just a shipper freak.
>>546101687jamalGODS
>>546101687This image really exposed the fact that /gig/gers can't read numbers.
>>546101590Looks like the obesakek dropped his clorinde image just like he dropped his torch....KEEEEEEEEEEEEEKEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEKAAKKAAKKAKK KAKAKAEHEEEEEEEEEEEEEEEEEK AHAAAAAAAAHAHAHHAHHA KEKEKEE
>>546101687Hu Tao (C0) didn't do enough damage to compute btw
>>546101687I still have not ever seen that double cryo mavuika team played by anyone
>>546101498anyone have the nipponese klee pasta about making her return the wishes that were spent on her
>>546101687>116>117I'm so good at math
>>546101960>>546101960>>546101960
>KEEEEEEEEEEEEEKEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEKAAKKAAKKAKK KAKAKAEHEEEEEEEEEEEEEEEEEK AHAAAAAAAAHAHAHHAHHA KEKEKEEDon't you guys feel dirty typing this stuff?
>>546101763The real trvke is that the Aetherpags in these threads are actually in love with Aether, not any of the girls
>>546102017KEKYPEEPOOPYSHARTY
>>546100374>hu tao