>Small guide for players who are coming back to the game and want to queue DoN, suggestions welcomehttps://rentry.co/d5guide>Nightreign DLC officially coming December 4thhttps://youtu.be/X6xQKNM1xA8>Latest Nightreign patch noteshttps://en.bandainamcoent.eu/elden-ring/news/elden-ring-nightreign-patch-notes-version-1024>How to host 6 players lobbies with seamless coophttps://files.catbox.moe/we1zur.png >Nightlord resistances charthttps://files.catbox.moe/e24o74.jpg >Main Information Documenthttps://rentry.org/erpasta>Character Plannershttps://eip.gg/elden-ring/build-planner/https://docs.google.com/spreadsheets/d/19Op36P7gdVMkPzFQX6OsjZcfyUjdGOj7Cjk9qFAVj-U/edit>Interactive Maphttps://mapgenie.io/elden-ring/maps/the-lands-betweenhttps://www.nightreignmap.com/en>Miscellaneous Nightreign Datahttps://docs.google.com/spreadsheets/d/1meXOw4jR1hh7YXVMeijWwSDIXnCw6Tk4hTZPq2qvyK4>Group/Multiplayer PasswordergTouch Bloodstain: >>548638404
revenant
why yes, I do kill gnoster (phase 3)
>>548692323>mush and heolster both missing with their big aoe attacksWylders share the same braincell.
fifth for undercaker
>>548692754Wyldjeets are just mentally challenged, please don't trigger them.
gg adel
>>548693332gg adel
>>548693418gg adel
>>548692928I for one am in favor of that nickname.
gg chickengg duckgg tardigrade
>>548692323I landed the explosion that mattered
>>548693459gg adel
>people coming back to NR in good amountsfinally something to disrupt the circlejerk here
>>548693332>>548693418>>548693459>>548693601gg adel
wow lots of people beating Adel
>>548693854gg Adel
bg
that was....bad
>>548693693Finally people who wont have me blockedok this is epic
>>548692928Undercaker….I hope we get some good fat and thick art
>>548694059Fat, wobbly and jiggly undercaker cheeks?
>>548693854he is a very easy boss after all
>>548694059I'd stick my tounge right up there. (picrel)
>>548694059I want art of wylder walking in on duchess doing exercises to make her butt bigger, before she blushes and tells him to get out because she's embarrassed.
Total wyldjeet genocide
Godskin Septet
>>548693854When I started out he was the worst boss for me, but after enough play time I learned he's the most honest and fair boss, making him be default the easiest.
I can't wait to zip zoom grappling hook all over this place
>>548691991Only three bosses left. Kos is fine with the reused BSB + Gehrman moveset. About the lore. I noticed that Micolash's fight is a house of mirrors, and I think the game alludes to the fact that much of what happens is not really real. The game doesn't go for the “it's all a dream” thing, I mean, it does. Since you're in the “hunter dream,” but you get what I'm saying. And the tree motif that runs through the dream, I think it serves to distinguish the real from the unreal. Since in the hunter dream you can see other trees, meaning that each construct is a different tree. And I think that's where the great ones reside. A nice callback to DES/DS1.
>>548694241Yes, fat cheeks fat tummy fat boobies
>>548694456*sips*yep, i think i'll be bringing guardian to this fight
>>548694456>You have to fight all 7 of them>One holds most the aggro while the others slowly pace behind her.
>>548694456>dark souls 2 black knight halberd reskin on three of them
>>548694456I'm a lazy ESL myself. And godskin is such an ESL/fantasy writer name. They don't even see how silly it sounds, and any normal person will make fun of it.
ggs 3bugs And thanks for all the drops lol felt so fed
GG bugs, clean run!
d4 is cute, CUTE!
am I crazy or does scholar look fucking trash
>new abyssal depths mode>basically depths 5-10>blue enemies are added as a higher tier of enemy above red>black/abyss weapon tier added that is higher than gold>max gear slots increased from 6 to 8>you can randomly start scattered across the map meaning you could each start on a random corner when beginning a run, forcing you to regroup>fourth depth relic slot added to chalice>more respec options added for each character, like arcane duchess and quality raiderY/N?
>>548695851guardian needed competition.
>>548695664Presets are such a lame idea.
>>548695920D5 enemies already one shot. Plus, DON was just unfinished content they patched in later, their not "adding" anything to it.
>>548696617ESL
ggs gigalibra, i sure love getting oneshot by a stray pebble when half hp curse gets activated
Depths world for the new nightfarers is not a thing yet because they will add the bosses later but can you still play vanilla depths with one of them?
>>548696449awful take
Sorry was out of shards about halfway through.
>>548697252Names?
>>548696990Unless the game gives you “hero” characters with specific builds. Think about it, Solaire. It doesn't make sense. It would be cool to control a full Black Knight and try to run Nightreing dungeons. But just any random character is boring. “Eagle head” is lame.
>>548697505Not really. you just want a different game. go make it you whiney bitch
>>548697505cont.This idea came early in DS1 alpha. Where you control presets and surprise surprise. Solaire build is one of them.
>>548696948holy ESL
>>548697252I'm sorry Shifty. I failed you. Next time I'll drop you more shards.
gg gigarisi swear i was the only one that got lasered the entire fight.. less likely is a scam
gg big jelly, got a bit hairy there
>>548697505By that logic, you're lame. You should try marvel rivals where you can play "hero" characters with specific builds. Not this.
>>548698763you were also the only to get targeted with a wave
>>548698905I wanted to play with the character with his unique quirks. Like those “NPC control” videos. Like, everyone loves watching those NPC fights. So it would be cool to setup that.
GG caligo. Damn, that was intense guys, didn't really get a fiery incant to deal with him. Thank you so much for the shards gumbus!! I used them a bunch troughout the run, felt so spoiled hahaAbsolute goat had a relic slot just to have shards for casters... well played!
you would have to torture me to make me unironically type all of that out
>>548694621I like that they actually blurred what is and isn’t real. It’s technically a dream but it’s also very real in the sense that it’s just a window into another world.
>>548691991
>>548701536damn youre always ready to say that, what a no life haha, queue instead
No SotE items? What were they thinking?
>>548701056Terr, you cool with your bottom bitch doing all this?
>>548701973What were dey finking???
Tried deep of the night for the first time. I was afraid I wouldn't perform well, because I'm not very good at the game. But somehow one of my partners played way worse. At only level 3, he ran into one of those zones where evil nightfarers spawn. The other teammate followed. So I tried to help too. But we got 1 shot of course and all died. The same guy runs back in, and again thenother guy follows, so I try to support from the sideline(playing ironeye). We all die again. So I pin a different location and walk off to go hunt easier prey. The other two die two more times before finally following me. I managed to kill a depraved perfumer all by myself before they caught up.Then on day two, I lose sight of me team for only 30 seconds, and they both die to a single banished knight and a couple of banished soldiers, before I'm able to locate them. The guy who kept throwing his life away quits the game. Me and the remaining guy die to a deathrite bird at the end of day 2.So why did that guy want to fight the evil nightfarers so bad at the start of the expedition? Is it come kind of meta strategy? Or was he just retarded?
>>548701973HONESTLY the entirety of the DLC is pretty much ruined because of this.
>>548702190Is this a reddit repost
>>548702337I dont know if you can say retarded on reddit
>>548701973You're going to freak out when you see the sote gear
Do you guys think ironeye will get a buff in the dlc patch?
>>548702337No, I just speak in complete sentences, and full context. I know that's a bit unsual for the autistic non-verbals that typically post on /vg/.
>>548701973this is the last update for nightreign i think most of the dev team is now working on the switch 2 game
>>548702773the last update itself has numerous updates, it'll be fine.
did i dc?? where did u 2 go
what happened
rip that libra run, chewsday and all that.
>have -12 less likely to be targeted>still get targeteda tad bit strange methinksalso fucking sick dodging a ground seal only to dodge into another one
chewsday innit
>>548691991I love this. This is unironically the best thing to come out of the DLC. Is there more?
>>548702190yeah its a meta like gaols
>>548702882>>548702918can u guys not rejoin? D:
Come to think of it, it was going to be normal libra anyway, you never get so many LL items on a ED run.
>>548702958I got dc'd from steam, we won that just in time...
>>548703135are you still inn the shelter? im coming
>>548703041
>>548701973They were thinking “Alright we’ve hit our sales quota on this dogshit let’s shit out this one last big steamy turd and get it over with.”>>548702309This.>>548702496Depends on the sub I believe.
>>548703135I already clicked the cancel rejoin, so I'm out.
leddit claims this interview states new weapons will come sometimehttps://www.gamersky.com/news/202512/2052747.shtml
>>548703135nvm can't rejoin session ended
>>548703187waiting by libra
>>548703118I know some relics increase you power when you defeat nightfarers. And they drop good weapons. But at the same time, how can you hope to defeat them at level 3? They're way too stong.
>>548693205So true exejeet saars
>>548703375good luck!
>>548702190This is going to be fun anon has been laying the ground work for this rp for a few days,
>>548703345>>548703374bwo...
>>548703346>new weapons confirmed in same response that acknowledges Guardian is dogshit uhhhhhhhhhhh birdkeks? Wtf do we do?
>>548703642>have very low pick ratesLmao. Flockjeets just can’t catch a break.
>>548703346>will come sometimeYeah, on the day of the launch.
>>548703041This one kinda looks like duchess but probably isn’t
>>548702190First of all playing Ironeye and bragging about "doing better" than your teammates is fucking crazyAnyway yes they are cursed camps. You're supposed to stand at the edges and kite them out (for example the entryway steps at Great Churches or the entrances of encampments). Enemies their have 3x the stats so running in and aggro'ing a ton of mobs is suicide and creates a giant pile up. Sometimes even after killing the invaders we don't even bother doing the boss inside. You guys probably aren't fighting them correctly. They are janky NPC's who oneshot you. Use range, grapples, poison, cheese them from ledges, etc. unless you know what you're doing. They have iframes so if you crit them or knock them down you can't just keep attacking like other enemies.
>>548703642lollmao
What are they gonna make the Undertaker darkness skin if she already shits bats? it's gonna be edgy af
gg smol goat, got there in the enddamn near sht myself when he started doing the rage attack..
>>548703642rogue bros...?
>>548703791No one is ready for these mini godfreys
>>548703995how were you immune to chewsday
I will be playing faith guardian next game. A warning has been issued.
>>548703642it's unironically over (for birdfuckers, we're so back for literally everyone else)
>>548703283>>548703813Amazing. Isn’t the second one Iosefka from Bloodborne? Looks like her outfit at least
>>548704020People will hunt these fags down with extreme prejudice so they can get the axe and do charged r2s.
>>548703395you can kill a solo invader at level 2 just fine and then do the POI if it's something easy like mausoleum knight or abductor virgindouble invaders I'd save them for later yeah
>>548704049cheater
>>548704049He was blue.
>>548704049i do not know!
>>548704052>>548691991why is she associated with tentacles? I didn't see any in the trailer
>>548703819oh also Invaders are really good for 3 reasons>Night Invader relic effect - 7% permabuff for all damage per invader killed. Usually there's 2 invader camps which gives 3 invader npc's in total for 21% free damage almost every run>Night Invader's drop a guaranteed purple +2'd starter gear you can use at any level. If you get lucky with the skill it could be a good nightlord weapon even.>Ninvaders drop a FUCKton of runes. Doing a double invader camp at level 2 usually rockets me to level 6 or 7.
>>548704094Maybe, might be duchess in her white cape though I dunno
>>548704215Because she attacks with them like Micolash in the launch trailer. Snake imagery is also terrestrial tentacles.
>>548703791Every base game's soldiers after Limgrave should have looked as visually distinct as these guys.I can give a pass to cuckoo knights because they were basically unofficial carian knights, but the rest of them should've looked way different
>>548704094Not iosefka, it's the waifu on the second floor of bergenwerth whose name I forget
the new character skins will cost Hollow Murk™ so you won't be able to unlock them all immediately with your 6 gorillion stockpiled murk
>>548704215Have you seen her ult?
>>548704540There won't be new skins for existing characters.
>>548704362The literal only change any of the low tier soldiers have is the redmane knights have unique gloves. Thats literally it.
but there will be new skins for the new characters
>>548703642who's the rogue?Also google's automated translation is awful, we need a true weeb to tell us what the interview says exactly
No new skins
>>548704698But still I'm really happy with how Messmer's soldiers ended up being, with the numerous tents It felt like they were an actual functional and active army
>>548704859無頼漢 aka Raider
>>548704859Raider given how the sisters have been pairing him with guardian since this interview that they just released. You didn't think it was strange how the sisters started doing that a few threads ago?
Dogshit caster raider
>even they know the forge will suckjust let use pick any affinity we want
>>548705187You stole my negation
>>548705187Name?
>>548705302zorb merchant
>>548704929I like how they felt like a little squad patrolling like they should. When I got killed by them, and they killed me a lot, it was a clever girl messmer soldier doing the running slam on me from off screen while I was distracted by one screaming at me to get my attention.
>>548705302Fortha B. Locklist
>>548705206They should do one for magic.
>you fucking sweats>t. Ishizaki
They should add a POI that lets you change your relic loadout mid-expedition
>>548705668Link the interview
>>548705668>even the Mignight 5 difficulty has been succesfully completed by many playersKek from knows this isn't true they already released the player data showing they know.
>>548705206My immediate thought when I saw it was pure random was "that's dogshit". It should let you pick from like 5 random weapon arts to mitigate RNG.
>>548705668Imagine being this out of touch with your community
When I go to heaven, she will be there. I will lay on her chest as the sun rises, its rays warming the room. Then, I will finally rest.
>>548701056Np! I always like helping my casters.
>>548705756That sounds useless
>>548705668did he just confirm there won't be anymore content after the dlc?
>>5487058703% of, let's say, a 200k active playerbase is still 6 thousand people
>>548701056>himIt's a she you bigot chud>>548705948simp
>>548705943who's that?
>>548706085No, in fact they announced that their adding new weapons after the DLC drops.
>>548706205I got to depth 3 and stopped playing entirely. I think I made the right choice.
>>548705206In the Gamespot footage. The footage they specifically showed "we want our players to see this before making their purchasing decision". The footage they limited on purpose. You can see someone get Seppuku replaced with fucking Impaling Thrust KEKKKKKKKKKKThe one use case for this was already "well maybe we can use it to guarantee lightning slash/flaming strike instead of lightning ram/redmane flame". No man you can put in redmane flame and get back White Shadow or Ground Slam or some garbage. it probably doesn't limit it to the same affinity you put in.
>>548706085No, he just said D5 will be the difficulty ceiling in terms of number bloat.
/erg/bros... we're retarded
>>548706205>successfully completedcheaters all. D4-5 are set up to filter you back down with loss penalties so anyone in D5 let alone at 9999 has been cheating.
>>548706085Haha you don't need an interview to know that. Fromsoft is just doing the bare minimum to reach their shareholder goals.
>>548691991Never noticed that Logarius is a Latria reference. The plotline ended up taking that DS2 direction, I know that DS2/BB were in production at the same time. But it's interesting that the writers came up with the same idea. Also, Cainhurst is still the worst optional area in the game. Nightmare Frontier has better loot and storyline.
>>548706403I mean with 1000 games being 4th place is pretty good?
>>548706327Source? Also what the fuck is that question? Rouge double jump slash?
>>548706330Sounds like you're still insecure about it. Maybe you should just get to D5 and stop worrying so much?
>>548706681Rogue=raider. He's talking about Raider jump attacks being shit in depths mode. The source is the interview Ishizaki did with GamerSky
>>548706330t. nigzuk
>>548706681Raider jump L1
>>548706681>Rouge double jump slash?Sounds like it is describing ironeye with his +1 dash. But he's super common in depths. The weird language might be referring to the skips raider can do with his stele but that is a stretch.
>>548706327>We want to improve the experience for all players>For example, ranged charOh my god do they play their own game what the fuck this is the most out of touch shit they could have said
>>548706681It's obviously some machine translation. Get some net literacy buddy. Were almost in 2026
>>548706290A queen. I accidently posted in the wrong thread lol. Just know that there is no reason to support israel. and if I were to die for the price of holding her hand, all my life would be well enough lived.
>>548706327I think this is translation fuckery and the new weapons are coming with the DLC patch it would be weird as fuck for them to add new weapons at any other point
>>548706205It's prob 3% of total players ever, so total sales? It's not just pc those stats are multi-platform
>>548706958Yeah, almost in 2026 and the computers still can't do their fucking job.
>>548707067she kinda mid af though
Devs are aware people quit upon seeing guardian and raider
>>548707291Either anon is gay or terminally online.
>>548705234wait which boss was this for?
>>548703642kek
>>548707361This has given me hope for SOTE weapons
>>548701973I'm hoping they're just putting it in a different update that comes later, since there likely realised there wasn't really a way to ensure you don't just pass them to non-DLC holders in the base game mapsHowever, they could have just done it at the same time as the DLC, so who knows.
>>548707527Seeing the launch trailer gave me hope and confirmation.
>>548707394but enough about your simp posts
>>548707527
>>548707614I was singling out that the anonymous simping for that A.I. bitch is either gay or terminally online.
>>548705668Even I managed to get to D5. It turns out you don’t need to get good, you just need to stack damage as a caster so you nuke everything before needing to learn to dodge.
Great hollow shifting earth spoilers>has DLC story ties, will be introduced with a cutscene the first time>more built vertically than horizontally>less but bigger PoIs, multiple bosses in each>"cursed" PoIs, could either be puzzles or modifiers>no central castle but two big fortresses split between the sides of the map>there are several crystals on the map which you can destroy, their location gets revealed automatically on the second day so they're probably important
that didn't happen
>>548707880did you learn something?
>>548707520>Penguin ...oh I get it, cuz he 'slides' across the ground, that's pretty good
>>548707942No because nothing happened, all is well
>>548707880i would ask for Names? but as you said, it didn't happen
>>548705790>>548706681>>548703346
how much will the new weapons dlc cost? im assuming they will also put in everdarks for the new fights and maybe heolstor
>>548707880>>548708064Names?
I heard Rogue is getting buffed?
how much will the summer swimsuit dlc cost? im assuming they will also put in pool noodles for the weapons and maybe beach balls for rev's summons
>>548709046You mean the ruffian?
>>548709313you're thinking of the rapscallion
ragamuffin but yeah
>>548706338Impaling Thrust is great though.
queue
>>548709531Its ok I guess
>>548703819The guy that kept throwing his life away was Ironeye too. I was going to mention that, but I didn't want to make my post too long. But I deliberately picked Ironeye to compensate for my lack of skill. When I saw the other guy pick ironeye, I thought, "lol, looks like we're both unsure of our skill".The other ironeye was not atanding on the edges and kiting them. Because I was draggin my feet a little, reluctant to go in, they had already aggroed everyon by the time I got there. Dogs, demi humans, bubble blowing dudes, and a recluse nightfarer were all causing chaos.On our second attempt, I stuck to the sideline and kited, which is why I survived long enough to hear them die. I tried to get a vantage point to shoot them and save them, but that just made me a target, and I died too. After dying twice, I had enough sense to get out of there. The other two throw their lives away a third time, and the other ironeye spammed his pin in frustration as I made my way to the depraved perfumer.My post wasn't to brag about my skills. But condemn his lack of good sense. Who throws their lives away to nightfarers 4 times in a row, while you're only level 3? Come on.Since you say it's doable, I might try it again. But if my team aggros everything again, then I'm not staying to participate in their follies
>>548709531Impaling thrust is S tier v revvie wombs
was there more new content / videos outside of the gamestop thing
>>548706327Why the fuck is he translating from chinese? What's going on there?
>>548709531EEEYAAAH!!!
>>548709718just miyazaki's apology video saying rollslop was a mistake
>>548709443No no, you mean the Rascal, right?
>>548704142POI?
>>548709776
>>548707221translation?
Praise libra
>>548710324gay
>>548706330yes, you did
>>548710324gg birdman
>>548710709Undertaker will remove rev from existence. ShiftyDuck your days are numbered
>>548710790no healseal = no buy
>Want to help friend >Keep fucking up and becoming a burden I play this game so much, how the hell am I still choking this badly
>>548710790Dont worry rev, I'll unscrew your arms and legs and eep you in the trunk of my car. You'll always have a use for me.
sekaight your seal had heal on it and u didnt use it for the revenant which is why I pinged and gestured, sorry
>>548711119Link her steam profile
>>548709686invaders at level 2 are extremely doable. But having rando retards like that absolutely make it a pain in the ass and can eat up the entire first circle.We had a rando once just run in STRAIGHT through the ENTIRE church. Fucked up the NPC spawn and positioning, aggro'd the golem, aggro'd every demimonkey. He ended up ragequitting, but me and my duo partner barely made it out with the NPC's loot orb and our runes.And even then, after all that BS and even full wiping once or twice, we made it out with a purple, our invader buff, and level 6. That's how much of a power spike it can be early on.
queue please!
GGI think that's the fastest castle clear I've had.. brutal. Team DPS bitches-that-make-anon-jealous-of-our-natty-GAWD-relics
>roll through caligo's ice breath>literally no more ice mist around us>alive on the other side>die with nothing around us 1 second later
>>548711636shit scented mushjeet post
>>548709654On arcane man? Staring weapon status+other status must would be great
>>548711843And good clutch clumsy, cold. Idk what was up with that frost breathe... some kinda uncommon move?>>548711918I KNOW RIGHT. what's up with that
>>548711636Can I get a rev clenching fist in rage like that one rat meme
gg mystery heolster
>>548710790>your days are numberedHow so exactly? I mainly play magical rev so I dont see how undertaker can replace that
>>548711918>>548712035
>>548712425hey shifty :3
>>548712425Shifty gimme my crystal staff rghhh
gg, trish why did you dupe some random +sorc item but not that full hp negation dagger Lotus dropped for you?
>>548710790undertaker seems more like a replacement raider than replacement rev
>>548712439wat
>>548712647Uhmmm I forgor soryThat was rly nice of lotus tho
>>548712538>>548712547quack
>>548712913The thought process was that all resistances up would be nice for the frost. I actually think I didn't get frosted at all. Also when I died I fat fingered my roll and I rolled backwards or smth ugh, I'm on KBM.
>>548709531>>548709705Sounds like a Wyldman move…>>548709867Yeah right lol he’ll die before that happens >>548711636Cute Aryan coded flower scented post
>>548713120thank you grok
>>548713084tranny
gg minibugs, slogfestSekaight please read >>548711119
>First game of D4 ever>First two POI next to use invaders >Raider and Iron eye that run into invader camps and aggro everything>Night boss 1 at level 5, they're at 4>Lose to demi human queen because they didn't refresh bars at a graveWell I'm officially in the quiet out at raider club
I have 3 deep relics for recluse that have magic attack plus 4 but they have reduced vigor and arcane or flask usage reduces negation. Is it really worth it putting them all on?
>>548711119>>548714031my bad i have not played really in 2 months i didnt think about it lmao.
Tourist queueing PSN DoN, erg pass.
PSA that since the actual patch and content is out tomorrow pre midnight they are going to flip the switch 1-2 hours early like with Adel to lessen server load so please be ready at 22:00 EU time
>>548714836we all agreed not to purchase the dlc as a statement to fromsoft
>>548711594"extremely" doable? Really?
>>5487153422 no but 3 yes. 2 is still easy with the right characters.
Do statuses stop scaling past a certain arcane value? Like will it be worth to give Scholar even more arcane when he already has S scaling?
>>548714176going by that story you should join the quit out at ironeye club too
>>548715164"we"? Nigga who is "we"?
>>548714836no patchnotes yet?
>Scholar keeps abandoning the group to get items just to 3 bar to a red normal enemyJust delete this character already
Well I nearly soloed caligo from 40% for you two but honestly no negations, no fp and a repeated evasions curse made it kinda tough
>>548715965we usually get patch notes after the patch is out.the patch is not out.
>>548716092Names?
>>548716297Nah it was fun wacking him with a horn
GG bugs they got melted lmao
>>548716434Surprisingly fast despite only 2 people doing any damage.
Make it clap undertaker
lotroons sisters we are jobbing on stream
>>548713790Any time terr>>548715164This but unironically
gg wylder team
>>548709963What does POI mean?
GG Wylderbros
>>548716801Place of interest
>>548716527Making it clap like Undercaker!
>>548717342sit on my face
Forgot how ludicrous input delay in From games is.
>>548717342Spanking this anons Phat Wobbly Twerkmeat
>>548717554Do not call it twerkmeat or I will punch you
>>548716801ぽい
Erm, how am I supposed to buy the DLC now?
>>548717430Sitting on this anons face while I play!>>548717554Enjoying being spanked by this anon!
>>548717689Don't threaten me with a good time
>>548717769buy key on 3rd party site
>>548717952that's wylders wife
queue up
Cardboardcupcake it's time to post your butt
>>548717837reddit ass post
cardboardbutt
>>548718386Whisper me if you want to see my butt
>>548718039That's not Duchess, anon
GG hotdogs, i had like 3 attack on full HP, ate that hotdog
>>548718617like on twitch? Can I see too? you're my crush mommy
>>548718672He has multiple females in his possession
>>548718672that's his sister
/erg/ boys tier list based on how built they are to impregnate /erg/ girls(final version before the DLC)>S tiernezukEXTREMISTMAN-BIRD>A tiertideaschevpepewulfbelansludge merchant>B tieryltairedinglemittpracticeacedevil-knightnine-boxsalvareyerbaterominervazorban>C tierterrtrishpivvotzanemiquellafaithful>D tiergremlinshiftyduck>Jeet tiermushdaddy hubby anon
>>548718875Yes.
>>548718617But you already posted your tits here might as well post butt
>>548715504I know iron eye is a good character. I now know raider is always bad. They died the most.Second match ED Libra btw.
>>548719257based list
holy fuck I am so cringe
rip auggy
>>548719726i hate this fight so much. i dont remember his dash through being active for so long
>>548719726the ress into floor aoe felt awful but not your fault, cant believe we got stomped that hard but the entire run felt kinda off idk if it was the spawn location + invader ruins that made it weird or what
>>548719726>everyone 3 bar before half healthyup you're all being demoted on the terrlist
>>548720064woah hold on I only went one bar
>>548719271My account isn't verified so I can't whisper, please help
gg smol goatlotus you didnt pick up the bow with less likely that i bought for you for 50k!! how dare you
>>548719545
>>548719257how do you climb this list, is it not being cringe?
>>548719257How come tidejeet didn't get demoted to jeet tier? Considering nezuk is a meme and extremist is awful does that make the rankins MAN-BIRD > Tide > rest?
So basically I’m just gonna not buy it (the forsaken hollows)I know….. UGH I know…. I’m sorry!!!!!!!!!!!!!!!!!!!It’s just that I’m not gonna buy it is allHAHAHAHAHAHAHAHAHAAAHAAHAAHA
>>548720341I don't use LLTBT ever if I have a choice not to.I do not like how chaotic it makes fights. Could have dropped the staff too or something. Comet Azur and terra magika were dogshit spells but the 12% boost to damage was good.
people will unironically not buy the dlc, then queue DoN just to drag ergites into non dlc games
>>548720690'zukGAWD is s tier doe
>>548720961I'm concerned too
Welp, second deep of the night attempt is a bust. But at least we managed to take a night invader art level 3, only dying once.This is hilarious. They made the game harder, so just getting to the second level is a struggle
Does anyone here play the bean in d5?I'm wondering what builds people use make her viable at depths where people are playing seriously and not memeing with colossal weapons.
>>548721597defeating enemies increase ult gauge +0/+1hoarfrost stomp or wraithcalling bell, at least one of these twonight invaders+gaolsas many affinity/incant boosts as you can get
>>548720961Yep, another Blocked User classic
>>548721726I feel like even then, you're just playing her as a worse Duchess/Recluse.She desperately needs a buff.
>>548721726What the hell is the point of hoarfrost stomp on revenant if all it does is kill starter camp and first poi slightly faster, you could be using something more worthwhile instead. Melees should be the ones using hoarfrost stomp
What a hilarious adel fight. I don’t appreciate bloodboon being stolen off me though
>>548722049NTA but hoarfrost does so much frost that sometimes I'll keep it until the end
>>548721915>you're just playing her as a worse Duchess/RecluseThe difference is that you're using incants. This is both a positive and a negative. On the downside they're kinda unreliable and you may not find what you need. On the upside you can target a bosses weakness, like using holy v gladius and heolstor while sorceries are basically always magic. She's also got the best ult in the game.>She desperately needs a buff.She could use a buff but she's honestly mot that bad. She's better than Executor, Raider and Guardian but worse than Wylder, Recluse, Duchess and Ironeye which puts her right around the middle of the pack in depth mode.>>548722049>if all it does is kill starter camp and first poi slightly fasterIt lasts until the start of the game to your first good seal. That could be the first POI if you're lucky, but it could be half-way through D1 if you're unlucky. Hoarfrost/Wraith makes runs consistent and reliable which is very important in DoN.
did they change the dlc to deluxe upgrade pack? i can't even buy it
GG adel great team!
>>548722143Depth 5 Adel literally just one shots me.
>>548722740>>548722689Were you guys the guardian and ironeye?
this thread reeks of estrogen
>>548722923Nah, different adel
>>548722923wylder wylder ironeye
Oh, we're getting a strength and faith character too? That's neat. She might he more fun than Raider
there's too many erg girlscuts are in order
New From game at TGA 'Project Dust'It's a very short teaser (1 minute), showing a baroque looking gun and some runes glowing up. Don't start posting this all over reddit although I assume it'll start showing up tomorrow anyway, since Bamco sent us the concept art to upload to our site.
>>548723236but I love girls
>>548723236I love girls who do a little cutties, especially on the thighs
>>548723287it is possible to have too much of a thing
>>548723236im the best girl
>>548723282Big if true
>>548723438true but this isn't one of those cases
>>548723282I can't be seen taking photos so I can't do better than this sorry
I do think it's funny that even in a thread as female-coded as this it's easy to tell who's a troon and who isn't
>>548723445kirrykip scented post
>>548723524>>548723282
gg cold dogsreally not liking dormant daggers
>>548723950>>548723524>>548723282Last one I haveGoodbye
fuck this game maaan abayo winstreaknever had this shit happen before until last week, fix your fucking game FROM, even putting my vpn doesn't let me reconnectcool now chan won't let me upload files either faggots
when do we get to download the dlc file? don't want to spend hours downloading it on launch day
>>548725307need to make one "normal" post before it lets me upload a file to prove i'm not a fucking pajeet bot or some shitit doesn't even give an error code for this disconnection shit
>>548723282
>>548723985Dormant daggers... On Duchess?
>>548723282Doesnt look like FROM concept art
>>548725898it's the default dormant it's just easier to say
>>548725547doing what?
>>548726548don't respond to frogtard
Fun games pidf, love new fish since they get to think I’m good until I throw like 5 games in a row
>>548726750**** the goat
>>548719257You still need to drop yourself down a tier Terr>>548723236It’s balanced out when you take into account the ones that are biological
gg regulardark caligomy cat was griefing me so hard this run that little faggot is getting added to the blocklist
ohhh, this might be big for lightning rev
>>548706403This is an obvious shitpost, anyone who has played either Dota or LoL can confirm everyone who plays those are completely fucking retarded.
>>548727156gg normal caligo's random floor frost bullshit is heinous.
gg hotdogs grilled with mustard and coleslawlotus why didn't you take the ritual shield talisman..
>>54872783830% full hp negation wasn't going to do shit when I had half the hp everyone else had. Wouldn't have helped in the end since I got wombo combo'd by the dog when I wasn't even the main fucking target. KMS
>>548727660I have to remind myself to not bring deathblight relics to caligo because I got deathblight instaprocced by the crystals
>>548719257Bird talons typed this post
>>548727838too big
>>548716037No you’re going to be forced to play with the entirely useless character and like it
GG. Gumbus WON.
>>548728774GG Fulghor, Unfortunate dc but we made a good duo!
ggs gigadel Nice chill run though thanks for the ancient dragon save lol
gg erg girls
>>548730503did you see the screaming effect hovering above roxys head too or was that just on my screen?
>>548730509i'm not a girl actually
>>548730663yes you are
why are we in d4
>>548731119gumbus+roxy game? that's my bet
>>548731119why not
GG on small bugsShame we got THAT stacked only for it to be normal bugs instead of ED. It was kind of a letdown.
>double marais and graftedretardedly lucky run only for it to be regular bugs, sad
>>548731487Agreed. But at least now your hp bar is as big as your waifu's tits.
>>548723524>Feet blockedYou've failed.
>>548730652Not sure I saw that, but I did see them fly all over the sky lmao
>>548727942it definitely wouldn't have saved you from the fire wave but you can probably tank a bite and the fire residue>>548731607health is stored in the boobs
>>548731789in wylder's boobs
>No SOTE equipment for DLCWhat the fuck man
>>548732729No refunds :)
No miqqy and mally in the dlc. It so over.
>>548732964>preorderingRetard.
>>548705943looks like a man tbqphwy>>548706330you did, objectively
>>548706520Cainhurst is great your taste needs work NF has some cool areas but it’s kind of whatever after your first runaround
>>548707735>least retarded birdjeet>>548710709reddit image
>>548733114nta but I bought it because scholar looked cool but I got gigacucked because he's shit and will be borderline unplayable and unfun as fuck and I regret my decision immensely fuck you fromdogs
>>548730663You will be after I’m done with you>>548712724Those cats were killed by the Chinese with CM poisoning. What that has to do with anything idk
GG smol adel yo first time I play with duchy, nice to meet you
Patch notes when? Datamining when?
>>548734043tranny lobby
>>548733679How hard is it to just wait until it's out? You can't blame Fromsoft for your own poor decisionmaking. It's not like they mislead you. Hopefully you learn from your mistake and stop pre-ordering shit when you barely even know what's in it.
>>548712665she will replace both and replace wylder too
>>548732979They were so cool. They deserved a better game.
>>548734043gg kind of wish it was ED I was decked out that runso you're the power couple I've heard so much about nice to meet you
>>548734206We will be getting triple Undercakes for weeks. 9 consecutive ults on every boss
>>548734126we're real girls doe
>>548734146They did mislead me.They made a cool looking character then made him shit.I was expecting a cool character because he looked cool. That's not an unreasonable expectation.Instead I get C- scaling waiting simulator. Oh joy.
>>548734564They made a cool looking character and appear to be delivering a cool looking character.They made absolutely no promise as to the function of the character nor did they promise that you, personally, would like how the character functions.Savvy up kid.
>>548714609Still in queue, 1/3!
I believe in scholarcurrent copes:- debuffing enemy resets resist buildup- parry shockwave from analyze is massive damage and poise damage due to how hard it is to pull of- int respec deep relic will still let you play as a caster- buffed perfumer bottles will hit like a fucking truck- PERMANENT BEWITCHING BRANCH MINIONS???
>>548714609>>548734756we generally play on pc, anon
>>548734764the perfumes are kinda rare though, merchants not even selling them sometimes. You probably can get like 6-8 per run at most unless your team also buy them for you.
>>548734756>PSNanon...
>>548734349lmao w-we're not dating tho and likewise>>548734472there's so many girls in erg...
>>548734764The biggest buff to him would be every single crate dropping consumeables like candy
>>548734969I think ideally you start with sparks and save them til nightlordleveling up perfume/branch category probably does not take many uses, you can grab every bewitching and also pop stuff like poison or ironjar early in the run to be able to use stronger versions of spark and bloodboil on the nightlord
>Beat the boss>DEFEAT>Lose pointsDid It desync and kill me on your screen or something mush???
gg ED augur
>>548735149arcane still affect number of item drop right? maybe if he get 60+ arcane then it will be like that.
>>548734764>- debuffing enemy resets resist buildup>- parry shockwave from analyze is massive damage and poise damage due to how hard it is to pull ofWhy would you set yourself up for disappointment like that? That's far too major a unique mechanical function to leave out of the explanations for how it works.>- buffed perfumer bottles will hit like a fucking truckThey already hit fairly hard though they're too rare to bother running relics for to make them really good. I wouldn't get your hopes up. Think more about the stuff you can reliably get.
gg gigarisbwos i did not just go 7/8 for maris lasers and 3 waves spawned on top of my head, what the fucks this guys deal??
ughhhh just fucking cancer this boss i hate itbtw you can use charged storm ruler to revive someone across the arena if they're 1 bar, you have to free aim it
>>548735497you need a torch to scare off the magic space slug they're afraid of fire
>>548735403yeah a lot of desycnprobably should have just revived the 1 bar rev
>>548734764You know you're just gonna give him Dormant Katanas and tear shit up with Rivers of Blood
>>548735463the shockwave thing has the biggest chance of being real, it legitimately destroyed the bird man's poise if nothing else
>>548735581i like ED augur, it's the great equalizer
>>548735648>1 bar revThe rev LITERALLY wasn't there on my screen???
>>548735737do all the blood weapons scale like that? might be time to bust out the blood blade build
>>548735403>>548735648i've been having some desync in games to day and DCs tooprobably FROM fucking with the servers before the DLC drop cunts
>>548736112Status buildup scales with arcane. Not the damage of the weapon itself.
>>548736112Some weapons have Arcane scaling and if you play like >>548735737 you're just gonna be a scuffed retarded Executer. Which is probably still better than whatever the fuck Scholar's intended playstyle would be.
>>548736076The rev died and DC'd on day 2 for me, I didn't even know she was there. Sorry roxy, Fromsoft servers hate us apparently
>>548734564>>548733679Truth>>548734756>>548714609Pctranny general sorry man ask around if you want an invite to the consoleGOD group
>>548737609>snoycuck seethe kek
>>548737609I don't think you should be bragging about having a player count so low you need to make a gay little group to even get some games going
gg bugsi think jumping to the top of the invader fort was a dumb move by me but ohwellthe game has been generous with full hp negation recently
gg tiny bugwas fun since I didnt get my crystal staff till the end
>>548738797Holy nightmare lobby of dogshit
>>548738743gg all good we ended up getting another free boss anyway
>>548738743yeah I think I never seen so many full hp def actually and wiggling
dang
Maintenance in 40 mins right?
sorry i can't stabilize my gameplay after getting chain downed like that
>>548738865but how do you know who's the duchess if i changed my skin
maintain me
damn, nearly had it, gg
lil bro thinks you can tell who's who by their skin
>>548739018>>548739041>>548739148Names?
>>548739018>>548739041>>548739148>another erg team wiped to shape of nightBravo!
>>548738102>”bragging”>pctranny has so much cum in xher eyes xhe can’t readPar for the course. Sad!
>>548737609Man this is just sad, I don't even want to shit on the consolecucks any more, that was funny maybe 10 years ago, now I just feel bad for them, its like looking at Make-a-Wish foundation kids in wheelchairs.
>>548739205worse it was basic gladius
>>548739181i can tell by sniffing
>>548737609Looks like you struck a nerve and made them dilate here
>>548739181well i can tell youre brown ill tell you that much
>>548739286lmao if true
>>548737609holy fuck talk about hitting the nail on the head lmao
>>548739205church rat at it once again
owning a console in 2025 is basically admitting you're no more than a mindless goycattle slave
>>5487390361hr & 40 I think.
>>548739583There's a message that says to log out now and it's in 30 mins
some /dsg/fag who doesn't even play nightreign responds "dogshit lobby" to every screencap among other things just to stir shit
>>548737609Post that made Terr cry, therefore you won (even though I’m a PCDEITY myself).
>>548737854>>548738102>>548739247>>548739575Massive trvkes which laid the ground work for the incoherent screeching of snoyfags well done
>>548739686nvm then. thought it was at 16:00 JST, which is 90min from now. but if the game says the servers are going down earlier then they must just be taking them down earlier.
Any leaks?
>>548739752Yes, that would be Terrjeeta, brown mastermind behind this clever-not-so-subtle post >>548739809
So are trish and kirry kip a couple now?
>>548739752lol come on anon “some /dsg/fag/“ like we don’t know who it is (he does play though)
>>548739809you made xher breakdown crying with this simple post good job
>>548740087Extremely obvious terrjeet falseflag post you're not fooling anyone
>>548740271who, terr? I'm out of the loop
>>548740425 (me) Oopsie I’m retarded and a thirdie meant for >>548740326 and >>548739809
>>548740231They're both girls. Girls can't date girls
>>548739996just the one from your asshole >>548740441correct
>>548736076wtf lolshe was on my screen and fighting the dogs that whole time
GG DDKSorry Sens I know those fists were for me but less likely just didn't interest me. Also thank you for helping me kill that royal Rev, really wanted dagger and talismans both. Black Flames on cr2 are too good.
ggs Gigahorse Sorry for falling over so much at the end not sure why things kept spazzing out for me
>>548740702>>548740231They're having gay tranny on tranny buttsex
Do not queue
1/3
You guys have been practicing dancing lion fight right? dont want to 3 bar and erg to make fun of you.
>>548741012I just wanted someone other than me to have lightning...I dropped them because that rev gave me the only usable lightning seal all game.
>>548741645I'd imagine with surge sprint, his most bullshit attacks like that spin would be fairly to avoid
>>548741645i never played sote so i will be getting raped by every single new enemy i fear
>>548741856me too niggy. we can eat shit together
>>548741856>>548741910Names?
>>548741645Nah I can't just react and read the boss and dodge appropriately because I'm the best
>>548742026my name is jeff
>>548741645nah I just react and get caught by every rollcatch and delay but it's just going to be normal games anyway so it won't matter
Wylder....
Wha the hell the YES INDEED lady fucking died and nobody said shit
>>548742793Hi
>>548743420I'm pregnant....It's Recluse's.....
>>548743185who fucking cares dude, wake me up when solaire or patches die irl
>>548742397Oldgodkino post in response to gay faggot post
>>548743504I would think the thread about dark souls 3 pontiffs pvp would care
>>548742026imthem
>>548741645no you're supposed to carry me
>>548741910Nobody is going to be eating shit buddy
>>548741645It's base game. I won't die
>>548743721go away lolg
>>548743485Gay
Hey guys, I'm new here. Just wanted to ask how do you deal with cheaters? I'm not kidding I see at least one cheater with perfect relics in 50% of my matches with randoms and it's almost always someone from Asia. I've blocked like 500 of them so far but they're like mosquitoes. I'm surprised I don't see people talking about cheaters much.
Damn nigga how poor are some of you people
GG ED Caligo. Sorry for disconnects. It all worked out fine enough though, I got decently strong weapons at day 1 with Ornamental SS and Godslayer GS.
>>548744524Not much you can do unless you plan on quitting out every time you see one.
>>548691991Licky licky
gg balancers
>>548744549hey $15 is more than most SEAs see in a year
>>548744524You're just schizophrenic, they just got lucky.OrIf you're playing with so many cheaters, you're in cheatersq and a cheater yourselfOrWhy care about cheaters anyway? At least they're not gacha-brained retards who care if a RNG small boost in a PvE videogame was achieved via brainless menu-mashing or smart workarounds.
I can't go back to 3 relics in normal mode. How will I find staves as a duchess?
>>548745650no, no, me because i want to play the game without modified code that was altered to gain an advantage. why is beating something without cheating such a foreign concept to you?
>>548745684its time to return to pebble/slicer/crystal burst
>>548745650Are you meme'ing or cheatersqueue is actually a thing?
RIP servers
Reminder to block trish, lotus, and DanteV for cheating before the DLC drops.
the first gaolmaxx + both invader camps game in a long while and its during maintenance
>>548746012lotus isnt a cheater. trishh maybe depending on if that one duchess/recluse build i saw a while ago was actually her
Well rip to that run. Stacked run with almost all the gaols and both invader camps down the drain for maintenance.
Damn. Didn't beat server maintenance.
>>548746012Based
>>548745772GigabaitedI still play with remembrance relics because I can't get any good ones. My morals are not stopping me from cheating, however, I just can't be bothered to mod the game.>>548745940It is. If the game detects you have cheated items, you will either be banned outright or only be queued with other players who cheat. Same as in elden ring.
what should we do until maintenance?
>Why care about cheaters anyway? who care if a RNG small boost in a PvE videogame was achieved via brainless menu-mashing or smart workarounds.
>>548746052>lotus isn't a cheater
>>548746092it WAS all gaolsmuh 40% bonus damage...
>>548703642>we're aware people are shitters so we'll make the most difficult to learn class that already can be practically invincible easier for retards who haven't put in any effort to learn himlol. lmao even
>>548744524You might run into less cheaters at D5, because cheaters are usually still shit players that can't climb the ranks because of fundamental issues their cheated relics cannot fix, but in the standard/ED que there is absolutely no filters.
My Nightreign updated. Is it just a pre-update thing?
548746217If they're achievable legally, it shouldn't be considered cheating if it's just bypassing luck.
How tall is undertaker?
dataminers should let us know is SotE weapons are in today's update soon
>>5487464245'11
>>5487464245'11" obviously
>>548746475they're in.
>>548746423so true xisteryou should cheat in a marais executor sword from a random corpse every run cause it's just bypassing luck
6 GB UPDATE, HOLY
>>548746424Shorter than me so 5'11
???
>>548746532ya I just queued it up dayum this is probably all the DLC which means dataminers will be able to tell us everything...
>>548746475chinese interview already said new gear and weapons are in
>>548746423It's cheating. Cheating is cheating because it's cheating. Stop cheating. Why ven cheat d5 is easy now we go on crazy win streaks.
8 wish I was able to play with dhifty
aight I'm outta here before you fags start spoiling shit
miyazaki just flew over my house
https://strawpoll.com/X3nkP1mlBgEhttps://strawpoll.com/X3nkP1mlBgEhttps://strawpoll.com/X3nkP1mlBgE
>>548746423>bypassing luckthe length that cheaters go to justify their actions is truly something else, are you also going to cheat out the percentages for attacks impaired on occassion since it's simply bypassing luck?
Okay, I will just cheat in a gorillion murk and spend days rerolling relics but even though my murk was cheated which is very very bad >>:( the relics are not cheated at all because I got them legit from the shop, got it!
>>548746925Honestly I can buy that. Ganbatte, anon-kun.
>>548746817Where is the "haven't bought nightreign yet" option.
>>548745684In forts and rises like everyone else
>>548745050So cute. Need that in my urethra. >>548744549Brown playerbase please understand.
>>548745940He's fucking with you.
>>548747040hmm yes sir, what are your experiences with having periods? what does it feel like?
>>548719257dogshit list
>Improved X Spell School buffed from 12% to 25% and doesn't stack.There, casters are now balanced.
>>548746423Luck is a part of the game. If you want to go down that road might as well just spawn in perfect loot for yourself during a run too.
>>548747251HUGE
>>548746817>A total of 6 people in the thread, repeating the same shit over and over again thinking they're messing with anyone else apart from the 5 other oldfag geezers that are the only ones who remainGRIM!
>>548747251
>>548747251CEkino............
>>548747251>no crystallianthey know what they did...
>>548747251NO WAY
>>548747251>starting beast clawyeah that's fucking RETARDED
>>548720813You always take it for ED libra, retard. That fight is chaotic either way.
>>548747251>Lightning spearXISTERS
>>548747251A new era of cheaters begins.
>>548747251The blocklists must expand
>>548747448Yeah, but beast claw's there, so... >>548499485
>>548746817I might main Undertaker if she has a good barefoot skin desu
>Servers undergoing maintenanceCome the fuck on.
Continuous fp recovery relic
>>548719070sisterwife*
I fucking hate beast claw because it makes an awful high pitched eeeeeeeeeee sound but its one of the best incantations in the game
Hey wait a second that one looks new
>>548747576>>548747743i want to throw rocks, not claws
shut up about mr beast claw, this will be the dragon cvltist era if real
>>548747756Continuous FP is definitely new.
hmm
Revsis rejoiceHeal is gone from starting equipment.
>>548747251These will be useless for D5. They will be on base relics only, meaning you'll have to roll the spell you want on a relic with invaders/gaols, or give up your 3rd base relic slot. 99% of the people who benefit from this will be the cheaters, every honest player will have to put in another 1k hours before they see combos worth replacing their current setups.
hm?
>>548747870>improved skill attack powerOh sick, I can finally make a build around just spamming whatever skill I find. There wasn't a good way to just buff all skills before other than hoping for weapon passives.
extended spell duration also a relic effect now
I wonder what the empty spots could be for???
>>548747742
>>548747984Cool but affinity damage is better
>>548747870I wonder about what percentgez they are and if they stack
what does this meanwhen YOUR damage negation is lowered? or when enemy damage negation is loweredI am assuming the later because of scholar, no?
THEY REMOVED TORCH WITH ITS 0 EFECTS FROM THE ARMAMENT-SPECIFIC LIST
>>548748071For shit like Lion's Claw or buttslam? You seem to misunderstand what I mean by "spamming whatever skill I find". I'm not talking about the obviously good shit like Black Knife or RoB.
>>548747895Heal is good. Rejection is not.
>>548747251DOOMBROS HOLD ME I CAN'T DO THIS ANYMORE
>>548747895>rejection
>>548748051hot and canon
wtf
>>548748212no sote weapons means we already won bigly
>>548747912easy for meI am entitled to it, because I have over 500 hours in this game, thus, I will simply give it to myself if someone asks? I am simply very lucky and they should try harder
>>548748192>killed support revenant for melee revenant lol
>>548747870IT IS TIME FOR MELEES TO SHINEYOU CASTERS HAVE REIGNED LONG ENOUGHWITH MAGIC+4 AND INCREASED AFFINITY DAMAGEMELEE BROS OUR TIME IS NOW
Chewing toy buff?
>>548748291>he hasn't unlocked all 10 characters
>>548748085Might be yours so if you get hit and lose full hp negation, succesive attacks bubble, etc. then you might nullify attacks so you could survive more than 2 hits
>>548748316humanity restored
LET ME IN
>>548746817I was expecting undertaker to be much more popular...I guess she doesn't really bring that much new to the table. I imagine only the metaslaves will like her, since she's basically just a diet revenant visuals-wise and better revenant design-wise, and those who like revenant don't like her for the gameplay.
>>548748316Giant Hunt bros...we're going home...
>>548747870What are these?
doomkeks about to see some suicide fuel
>>548748474>nd better revenant design-wiseNot anymore. Starting Catch Flame is kinda nuts.
>>548748085imagine it's the anti-"repeated dodges lowers dmg negation" effect
Giants seal updated and replaced flame sling with giantsflame take thee
>>548748625giant if true
>>548748085i think your own negation, to not make the repeated evasion curse that bad I think
>they are fixing the translationYOOOOOOOO
>>548748339dreglord unique effect I'd imagine
>>548748625fromsoft just forgot flame sling wasn't a giants incantation, didn't they
>RETALIATE WORKS WITH RALLYRAIDER IS FIXED
>>548748625The giant fireball with a massive charge up explosion? No way, I could see them replace it with 'O Flame!', but not 'Take Thee'.
>>548747895>>548748192>>548748310>>548748571Nope, she still starts with Heal + Rejection. Catch flame is just the default on the seals you get from the weapon rack in sparring grounds.
>>548748851giantsflame take thee is just a super fireballflame of the fell god is the one you're thinking of
>>548748851it's just flame sling except it will actually work with improved giant incants now
STOP STEALING ALL OF MY FUCKING POTS YOU FUCKING CUNTS
>>548748963You know what, I will steal your pots even harder. I will throw them right then and there in front of you.
update is up
>can't get starting spells on any character except for recluse and revenant because they are the only two who start with seals/stavesthis is the gayest shit ever loleven duchess who is absolutely a magicsissy, can't use them
>>548748906Fell god is the slow moving orb, take thee is just a fat flamesling with a bigger AoE if you charge it. Either way, both have massive FP costs that would be unusable before level and a pocket full of shards.
the icon now shows when you're at full flasks (changes back to normal when you're not at your max flask charges)>>548748946also has higher damage by default
wtf am i supposed to do with a 4 hour maintenance downtime
>>548749083you can watch this
>>548747870>Improve Skill Attack PowerBased for skill spamming exec>Sucessive Attacks Boost attack poweri cum
>>548749083Solo runs
>>548748874uh we knowwe're talking about this >>548747251
you guys wanna do an eldie ring fc while it's maint?
>>548749061oh no, the dedicated casters have an advantage in casting? how terrible!>>548749083what did you do before nightreign?
only the amateur dataminers are awake atm so they're struggling to find any of the new content including the characters
>>548749061recluse's staff also has shit scaling so this is literally just for revenant
>>548749207give up sis, it's overthere are no sote items
>>548749247>an entire category of relics dedicated just so that revenants can start with beast claw and not be completely worthlesslmfao
im updooting
Giant's seals starting with giantsflame is huge because it can easily revive 3 bar characters. It's a fairly common seal too so I expect all y'all to keep one if you don't have a better way to revive.
can now buy a guaranteed 3 slot deep relicdunno why you would though, those are way more frequently purple than regular relics
>>548749509oh using the everdark currency? neat.I haven’t used these in a while.
bruh you can start with wrath of gold bruh its not hot garbage bruh
>>548749661you realize this stuff isn't part of the dlc right? it's just an update
>>548749738shut up nerd
>>548749738cope this DLC is garbage
>>548747895Heal is good vs royal revenant though.Now she's going to be even more useless lol
>>548749891>>548748874
>>548749891They didn't change anything retard. See>>548748874>>548749160
>Wrath of gold sucks>ERM ACTUALLY ITS NOT DLC CONTENT THE DLC IS GOOD>>ERM ACTUALLY THE DLC SUCKS
>>548749971>ERM ACTUALLY ITS NOT DLC CONTENT THE DLC IS GOODwhere did i say the dlc is goodall i said is the changes here are just a free updatewhat strange posts you /v/tards make
release the patch note files
Talking about WoGDoes "Increased damage of charged incants" boosts damage of incants whose charging only affects range?
>add slicer>don't add catch flamehuhwhy is it 'O flame instead of catch flamethat's so weird but ok
>>548750135Yes.
>>548750135charging increases WoG's damage already>>548750237it's carian greatsword, not slicer.
>ERM ACTUALLY I LEFT IT VAGUE WHETHER OR NOT I BELIEVE THAT THE DLC IS GOODOk but was that the subject of the conversation? No? The original post was about Wrath of Gold and had nothing to do with whether or not it's DLC content or a free update? Yet you replied anyways? You have violated decorum and will be executed for your insolence and poor attention to detail.
>>548750382you have worms eating your brain or something man
>>548750382Oh look it's another indian spammer.
>>548750470>>548750556ESL retards.
>>548750712Your izzat score is falling saar
>>548747251The only good spell on that list is lightning bolt though?
Alright big guy... what character is SOOOO good you just can't replace them with... ummmJarwright Puppet or Revenant V2
>>548748625>>548748650>>548748823>>548748851hmmm
>>548747912Yeah, the cheater chinks will latch onto Lightning Spear Revenant instead of Crystalian/Carian Duchess or Recluse. Very cool.
>>548751070i can pretend im contributing by analysing power levels as an old manthat unique
>>548747251>Wrath of gold>Not discusFUCK
>>548750237Catch flame would be too good
youwy won bigly
New skins?
>>548751593no skins
>>548747251>lightning spear as starting miracleGod please let me roll one with dragon cult. Hell I'll take one without cult I would legit take a loss in damage for seal security.
>>548748297Yeah not sure what else he expected>>548751593>>548751626Yet another point for us…
>>548751737>let me rollkek we all know what you're going to do anyway
>>548751593Saw this on leddit but cant check ingame
>>548749083Something better with your life and/or your time.
>>548751881DOES REVENANT HAS A MIQUELLA SKIN?????????
It looks like this Rev buff isn't as good as it seems. Starter seals have lower scaling than other white seals you find in-game, they don't come with passives, you will still have that useless rejection on second slot, and you will need to sacrifice a relic slot.
>>548751881OH SHIT NIGGA
>>548751807>he's still seething that people with good relics cheatedWowie zowie
>>548751952Starting with a functional weapon for your build >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> dealing little to no damage unless you waste a slot on hoarfrost stomp anyway
>>548751952it's still a good start and better than the literally nothing you'd otherwise have.
>>548751881>CiaranThe fuck, Duchess is right there
>>548751881awoooogaa
giantsflame take thee being in every game now means recluse/rev will just solo stunlock every humanoid enemy in the game especially multi enemy gaols
>>548751881>xanthous crown scholarhilarious
>>548751881Those scholar skins are amazing if true
>>548752227Giantsflame stacking is now viable too.Fire revs are on the table now alongside lightning revs.
>>548752350HISSSSS
this is a new weapon passive, right?
>>548752389yeswho the fuck uses rolling attacks though
>>548751881Do we really only have the T-pose to approximate this?
>>548752389that's new, yeah.also sheesh 20% on the lowest rarity? that's nuts
They buffed executor's suncatcher attack speed and animation recovery by a shit ton
>>548737609>>548739296>>548739429>>548739771>>548744524>>548747040>>548748474>>548749293>>548749971Good and informative posts. Hit the nails quite squarely on their respective heads to say the least for anyone curious.
>>548752389>rolling attacksWhere da lightning ram build
>>548752389retaliatory crossed tree is herenothing for backstep attacks tho?
>>548751952No, it's incredible for rev.I can't tell you how many times I went against fulghor with my lightning maxxing rev build and never got a single lightning spear.
>>548752436source right now
>>548752389also the night 3 merchant sells fire pots now lol
>>548752415raider with an UGSwylder with powerstanced great spearseveryone when they will add crouching back
>>548752549Yes.YES.YES!
>>548752415probably you, every single time you dodge an attack and punish?
Yesterday I learned that you can't activate charged attack damage negation with frost rapier charged attack, even at point blank.That's completely retarded.
>>548752389is it the follow up attack after rolling?
>>548752549Scholarchads i kneel
>>548752415bro? your str duchess ugs poke?
>>548752549That is so forced lmaoEveryone has to pay the 12k scholar tax at the end so he can actually do anything in the fight and you better hope you're not fighting dogs or augur
Schlop Schlop Schlop Wylder Cummies in Duchess and Recluse Tummies Schlop Schlop Schlop Raising a happy famileee
so is the DLC launching after the maintenance
>>548752549can't wait to throw all my 4 pots at ED Gladius, then spend all the fight nyoticing
>>548752705you will have to pay more for starlight shards too if you have rev on your team kek
>>548752512I'd rather have a general 'moving attack' bonus for runs, rolls and backsteps than having each bloat the passive pool
Total doomkek death
>>548752767>>548752705If you aren't retarded you should have more than enough to buy multiple stacks and be 15 by then.
>>548752740Dlc arrives 13 hours 12 minutes from now
what's some good pvp hyper armor besides waves of darkness
>>548752729What animal is that?
>>548752789Not until we see dlc weapons.No character buffs/nerfs btw
>>548752740still like 15 hours to go i think>>548752705>has toyeah just like everyone already "has to" buy exalted flesh for the melee/ironeye and starlight shards for the casters? it's there for people to restock the shit they might have used on the night 2 boss, retard.
>>548752767Rev hasnt needed shards from allies at the end since week one when nobody knew where to find shards on the map. Scholar's issue is gonna be inventory space, even with the extra stacks.
>>548752890Shut the fuck up, /dsg/troon.
>>548752991>Rev hasnt needed shards from allies at the end since week one when nobody knew where to find shards on the mapNot entirely true, I've needed extra shards because teammates dragged fights on making me burn my stash to try and speed things up. I am still miffed about one duchess who forgot they still had fp and shattering crystal against valiant gargoyle until I used my own shard to regain fp to try and finish it off.
>>548752991yeah, realistically grease is the only consumable that's going to last through a whole nightlord fight, but that's also the most boring consumable to use
>Scholar the instant he gets his hands on frost/bleed grease
>>548753365What about Glintstone Scraps/Cuckoo's Glintstones?
>>548753365I like weapon buffs
>engage boss>scholar splits off to dumpster dive crates/basements/wooden chests>"dont worry guys, I found 2 lightning pots">the entire encampment of mobs follows him to where the real characters are killing the boss>he throws them and does 4.5% of the boss' hp>scholar runs off to dumpster dive elsewhere
>>548752415my new build
>>548753863I'll be spamming pick up button on all crates, then spamming r1 with status rapiers on bosses. Don't see the problem. I was using many consumables anyway
Scholar
[Incantation] Wrath of Gold:[Holy dmage]: 350 -> 420[Incantation] Wrath of Gold [Charged]:[Holy dmage]: 420 -> 567Talisman: Improved Damage Negation at Low HP50 -> 40Weapon Effect: Attack Up when Wielding Two ArmamentsWeapon Effect: Improved Attack Power when Two-Handing7 -> 1210 -> 1513 -> 18Weapon Effect: Improved Chain Attack Finishers10 -> 2115 -> 2620 -> 31Weapon Effect: Improved Charge Attacks6 -> 169 -> 1912 -> 22Weapon Effect: Improved Jump Attacks:6 -> 149 -> 1712 -> 20Weapon Effect: Improved Skill Attack Power:7 -> 1510 -> 1814 -> 21Weapon Effect: Improved Guard Counters:10 -> 1715 -> 2020 -> 23Weapon Effect: Improved Damage Negation at Low HP:29 -> 2338 -> 3048 -> 37Weapon Effect: Physical Attack Up:6 -> 88 -> 10
>>548753863that's how i normally play anyways.
>>548754242>nerfing the low HP negation buildwas that even good, I thought that was some exodia-tier shit
>buy monster hunter world last christmas because I want something new to play over the period>play it a bit but it never really clicks>this christmas decide I'll get neightrein>but end up actually getting back into monster hunter world and doing the Iceborne dlc and losing interest in Neightrein againMaybe next christmas then, I guess with the new DLC coming out it won't get discounted anyway, I also feel kinda burned out on er now too desu not sure I want to just fight a bunch of recycled bosses in NR.
>>548754242they introduced a new generic melee atk up and buffed all the conditional ones, I see
Ah yes, DmG negation at low HP, the cornerstone of Depths buildingthese nerfs will revolutionize the meta
also they changed the text on ultimate art gauge charge up
>>548754242MELEE BROS GOING TO EAT GOOD
sex with terr
so, why does melina think that destined death will be able to kill the lord of frenzy? destined death isn't anything special: it just allows things to die naturally under the elden ring. whereas frenzy burns away everything, including spirits, which melina is.
''improved running attacks'' is in, literally only useful for what, halberds?
go away bangladeshi
>>548754242I was actually building a low neg setup. I don’t think it was that good that it deserved nerfed though, especially when status effect probably fuck it over
>>548754756powerstance curved swords and godskin stitcher have really good running attacks
>>548754518>>548754385Probably meta in japan. You have to understand that the japan meta is retarded.
No depth for the dlc on release? i diddn't follow anything.
>>548754456Improved Melee Attacks goes up to +15% on purples btw, forgot to take a screenshot tho
>>548754756>>548754831wait I meant godskin peelerthe twinblade that gets an extra hit on its running R2
>try Margitt>get killed>go around Godrick's castle>reach Liurnia>meet some faggot in a rose church>get killedWhy do monsters give so little souls?!
>>548754862Now I need to find jap runs I want to see how they reliably get to 20%
>>548752227yeah guardian already did that who cares
Why are you still pretending to be new after this many years? If you're not, why are you playing like you're new?
>>548752436still bad even if true that's how shit it is
Can’t wait for this starting sorc/incant thing to expose the relic cheaters all over again
>>548754242Did they lower the fp cost?
Fuck, they reverted the deflecting change that made it so you dont get pushed back 100000km when you deflect heolstor attacks
>>548755054Who are you talking to?
>>548755195>he said, ignorant that people will get the effect within 5 minutes of playing because we saved up the murk to roll a shitton
Is the bean viable now?
>>548754980I made it up lmao.Only thing I know about japan meta is someone here saying that they weren't using gaol/invaders, and the meta was something like ISA x6
