>Patch 7.4 Noteshttps://na.finalfantasyxiv.com/lodestone/topics/detail/06944d892fd98cc00b2a28ff77edbafa4f7eef54>Starlight Celebration (Dec 17 - Dec 31)https://na.finalfantasyxiv.com/lodestone/special/2025/Starlight_Celebration/1zy049rho1>Heavensturn (Dec 31 - Jan 15)https://na.finalfantasyxiv.com/lodestone/special/2026/Heavensturn/xqnas3t3m1>Resourceshttps://rentry.org/xivgresources>Meetups• December 30, 9:00 PM EST | Primal, Famfrit, Lavender Beds W15 P20 | Spooky Club TUESDAY: Jack Frost and Christmas Evil >>551850761 • December 30, 10:00 PM EST | Balmung, Goblet, 24 38 | Winter Orgy >>551594463 • December 31, 9:00 PM GMT | Odin, Light - Mist W20 P45 | EU NYE Meetup >>551632661 • December 31st, 5:30pm EST | Malboro Shirogane Ward 15 Subdivision (X10 Y:8) | NYE Meetup >>551554478 • January 2nd, 6pm PST | Goblin, Eulmore ( 11.6 , 11.7 ) | Puppet's Bunker Unsync Glam Farm >>551870242 Last Time: >>552082310
Man I love Femezen so much it's unreal.
moonies
Pathetic.
my moonie whm is kinda like thishttps://files.catbox.moe/qx7jin.jpgwhat is your warrior of light like?
Post big tits
>Didn't get invited to the dogcordit's over
JOIN FRENCORD NOWhttps://discord.gg/E3ftNvvhttps://discord.gg/E3ftNvvhttps://discord.gg/E3ftNvv
>>552094139Hey...
>>552094120this is the same type of comedy as the manderville quests btw
>>552094153yes
catboy sex
my femlala has already received one creaming at the orgy
>>552094216catbox
>>552094230ok now post your ass
sunnies
who should i tribute in the meet?
Thinking about Mo Fu's ass
my femlala was rapedmy femlala was rapedmy femlala was raped
i love fiera so much bros
>>552075940But I actually do play on Materia.
>>552094153https://litter.catbox.moe/y5wc5p.png
>>552094272but this is supposed to be the tit thread
>>552094426more
>>552094350kanchelle
>>552094153please please please juniper post
cockwatch status?!?!
can anyone explain the obsession (non world prog) raid groups have going in on server-up? I get if they just really want to see the new tier and get in asap But a lot of these are week 1 or efficiency focused groups that go in right away server upFrom a strictly efficiency standpoint why wouldn't they just sleep to a reasonable hour, maybe get up 1-2 hours early and then watch vods or review established strats from actual world prog groups that cleared and then just go in there are blast through the fight in 30-60 minutes. Rather than wasting 2-6 hours blind progging it when the group is very blatantly not a world prog or blind prog focused group and doesn't have that skill set.
holy shit
>>552094120>transchelle at the meatWhy am I not surprised?
>>552094271https://files.catbox.moe/rje72v.mp4
>>552094038you can't prove that you don't have a free trial or another service account, and considering you spent hundreds on BP, this would be peanutsanyway, I'm looking forward to you being a sleeve again, I unironically miss it
>>552094168>2k membershow is this considered /xivg/?
stop putting big honkers on femezena good femezen is a flat femezen
>>552094552it's not
sorry im slow, y'all fr fr.
>>552094542not nice
>>552094372Slow down. Take a breath. Now, who did this and where did they touch you? Is this CC related?
>Nobody plapping at the orgy meetI should have gone to spooky club
>>552094665I couldn't make it to balmungWanna?
>>552094352Thanks bro>>552094550I'm an impulsive spender...but I do not have the effort for another service account. Hard enough to play the game on one account, fuck doing it on two.
>>552094168Why are all the channels locked down? Why's there 100 channels. Why do I only see EU ebins typing in the channels I can see?Holy fuck what a worthless discord.
someone post an updated list of people at the meetupI want to know if there's someone worth plapping in public since that anon said nobody would do it
>>552094665Who's going to plap when the king of melties and cockwatchers, kanchelle, is there?
>>552094665jack frost 2 is kino dude, you missed out
>>552094516theyre not that big anon...
>>552094542Album?
spooky club should be on balmung
>>552094665you missed an amazing movie too.
>>552094740show us
>>552094712See >>552094391
>>552094740you're LYING to me
https://pbs.twimg.com/media/G9dzi12XAAA6xMq?format=jpg&name=largewhy are femra women like this
>>552094705Give me a new ass pic to bust to
>>552094049arknights
>>552094665be the change you want to see, i know for a fact at least a few people are waiting for someone to start things off
>>552094823God I wish Ace and Saran's femra would do this to me
>>552094701depends who is this?
>>552094665H doesn't know that the plap meet is watching the Spooky Club movie
>>552094426>huge tits femezenMy fiddie will now simp.
>>552094826Sorry, have his cock on my face rn
>>552094839>there's a lot of bad generals but i like my favorite gacha general it's comfyendfield will end this, also endfield soon
>>552094823>those gartersI own the same ones, erm...
>>552094153
EU hours
>>552094774>>552094819gosh can i post one i have before..? i dont think i have any new material!!
Peamsisters have fallen
>>552094868i am a sunnie+...
>>552094953take something new now!!!
Peamsters union
>>552094879Fake news
is the anon who had a halicarnassus fc here
>>552094426i want breastfeeding from femezen
>>552094897Where's the gore cutaway
>>552094940anon its 4 am in eu land
>>552094815How long do I have to wait to be able to use it? I joined like 4 months ago. Also what does waiting change when schizos just join on 999 accounts.
>>552094960Do you let male charas hit?
Meetup pics so we can pick the ugliest nigga
>>552095030my fat wife keeps getting fatter...
>>552095037and the thread is full of eu ebins
>>552095047if you're a catboy
>>552094436https://youtu.be/BTGKzXWgJFY
I didn't have to crash the servers to get onto Balmung after all.
>>552094953Show me ALL your old material
>>552094468100% weakness to anal
What if we idled together ingame while playing warcraft 3
>>552095030post real race
My maleroe is like this
>>552094893i'm sure the threads will be a mess when endfield gets closer but i had fun in the beta with it so still quite excited
Evens doomtrain exOdds other game0 gather mats for combat job crafted gear
>>552095101god look how flat they are
>>552095035I dunno. I make pleasant webms.
>>552094003someone tell me the shoes here... and the tights if they're separate...!
>>552094153https://files.catbox.moe/9grxlv.jpg
>>552094436https://youtu.be/yuKU-Vcwspk
>>552095087pov mod link pls
>>552094107>>552094216My moonie is decorating but hasn't put down a single piece of furniture in days.>>552094436https://www.youtube.com/watch?v=O3PmFTPbyXo
>>552094981im at a public meetup!! >>552095119gosh i promise you dont want to see that a lot of it is really bad or really modbeasted :/
>>552095101my flat daughterwives
>>552095001https://files.catbox.moe/gmv1ij.png
>>552095148shoes are the paid EB ones, tights look like the 2B ones
>>552094168>noone posts in any channeli was baited
>>552095030Would look much better drenched in my potent seer
>>552095095post location
>>552095203Looking like one smoochable ass forehead you got there, dummy.
>>552095101which of the two posted this? and EB status? enjoying this song and NO is a massive bonus to anyone's EBScore
>>552095245thank you KING
>>552095010why are you looking for a halicarnassus fc?
>>552095194https://github.com/TiraesiascenGraven/POVPlus
>>552095132He is a gay maleroe, isn’t he?
i joined frencord but i cant send messages in general wth is this sever
>>552095278nahhh this thirsty ass nigga heard biofem and lost it
>>552095297because im on halicarnassus
considering what was posted last year i thought this meet would be spicier
>>552095350>>552094815
>>552095241They're lucky. But you can also satisfy 2 at the same time
>>552094705>but I do not have the effort for another service accountthere is no effort involved in starting a trial or starter edition account and fucking people in balmung uldah. there is no effort in buying a skip and a boost to not look like a bum either. you act like you need to invest 1000s of hours again into a second account just to plap strangers.combined with the fact that xiv lets you run two clients at once without any workarounds, it's really not a whole lot of effort.
>>552095367talk to Kouhai Chiisai
Where's the orgy?They're just sitting on a campfire watching a movie
>>552095332Y-yeah....
>>552095085>>552095130the magical hag outfit just makes her look bigger..
>>552094875I'll allow it.
>>552094436https://www.youtube.com/watch?v=xOGHjBPR7Sg
>>552095402fine... i guess we'll have to make a NEW frencord
>>552095446lynn i need to do my weekly pt, wanna?
i cheat on anon by using another service account to plap strangers
>>552095275Anon you fool, if you go for the forehead that means I can easily bite your neck
>>552095446Catbox?
Kanchelle and June are ERPing holy shit
What job do I make my fourth retainer? I'm thinking another miner or botanist
Just got Brandom'd all over my Arandussy...
>>552095101Both builded for my malezen BWC
>>552095404He doesn't have the double dick module installed.>>552095406I get that, but I'm just way too lazy for it all.
>>552095512>>552095537no
>>552095368problem is you have to be very careful what you say in public places in game. some spicy stuff probably in tells though.
Report all twitter tourists
I miss the old rylaicordshout out to my mans macho, mentha, kwystel, eekum mokum and facade
>>552095216>im at a public meetup!!thats hot, gpose now!!
>>552095512On a lil pt break until I can get another 91
Who can I approach at the orgy meet up for a plap?
>>552095216okay i'll take the old boob pics instead then
>>552095150DO YOU LIKE MROE????
>>552094665Spoopy Club is always the correct choice
>>552095234what does this even MEAN>>552095278the sunnie.. we EB platonically or for the bit (just annulled my EB with my fc lead since we got married so i could tp while catching up to msq actually lol) but thanks for actually listening to the song ^_^ one of my all-time favorites tbdesu>>552095296np {Poogie}
>can't go to the thingWell shizznit
Thoughts on SAM and SAM players?
>>552095241based
Is there a Balmung equivalent among the EU servers? Where does all the EU lewd shit usually go down?
>>552095621bro listed off every schizo in the cord
Latest drama?
>>552095645Ace will suck anyone off
>>552094168>Join can't see the general chatAlready a good sign of a dogshit discord>Everyones just using the lewd general to talk no ones posting lewd because they probably also can't use the generalSo it's just ran by retards I see.
>>552094756>>552094436https://www.youtube.com/watch?v=Nit1JXmn7Vk>>552094631sorry
my filthy working class femlala comes home after a long dayshe takes off her work helmet and shakes the dust and dirt out of her hair unbuttons her overalls and undoes her collar props her dirty feet up on her couchleans back, scratches her stomach, and cracks open a cold one
>>552095645You could probably ask anyone and both leave to plap elsewhere. No one is stupid enough to plap in front of so many shitposters though.
>>552095241more?
>>552095721Balmung.
>>552095690I'm rarely horny and this was one of those times where I am
>>552095125you still owe me my joi
"Do you come from a land down underWhere women glow and men plunder?Can't you hear, can't you hear the thunder?You better run, you better take cover"Buying bread from a man in BrusselsHe was six-foot-four and full of muscleI said, "Do you speak-a my language?"He just smiled and gave me a Vegemite sandwichAnd he said"I come from a land down underWhere beer does flow and men chunderCan't you hear, can't you hear the thunder?You better run, you better take cover, yeah"
Can I get some sideway tummy shots
>>552095715im a bottom fiera who plays DNC, i love them
>>552095715sb job quests were dogshit. shitters in pvpcrybabies about muh kaiten.
Femlalas with canonically big buttholes. It's not their butt that's big, but their buttholes.
>>552095367This >>552095427Don't know if there's any other FCs on that server.
>>552095443my femlala is on her way
>>552095735Arando meltdownBrando kept the discord but lost a friend
>>552095690cannot plap at spoopy club though..
>>552095801built for malera sam
>>552095241this my fav gay couple, you know what. Shoutout gay people fr fr. We are inclusive as FUCK here fr.
>>552095690I need head from this femra
>>552095645Ace just made me wahoo if you know what i mean
>>552095765She never went to the fridge though
why is this new femra samefagging so much
>>552095791we NEVER agreed to that
>>552095721No, all the sexpests moved to NA
I'd be more supportive of Grown Ass Man relationships (such as the Peams for example) if they embraced the fact that they were both grown ass men probably weighing anywhere between 150-300 lb and have hairy ass buttholes. NEITHER of you are cat girls. You are both grown ass men and it's gay as fuck.
>>552095721balmung is mostly EU tourists
HELLO /XIVG/ IM CONDUCTING A SOFT POLLHOW WOULD YOU RATE EACH JOB OF ITS TYPE IN TERMS OF DIFFICULTY TO PLAY/LEARN?RANK IT FROM EASIEST AT TOP TO HARDEST AT BOTTOM(i only put these results at random so you can easily copy paste it, these arent my actual opinions)TANK>gunbreaker>paladin>dark knight>warriorHEALER>white mage>scholar>sage>astrologianDPS>monk>dragoon>ninja>samurai>reaper>viper>bard>machinist>dancer>black mage>summoner>red mage>pictomancer
>>552095586Whatever. You're becoming boring as fuck
>>552095726also not forgetting crowe, guffy,dreiga,kani,algy and uhhhits been like 5 years....
>>552095715they're cool unless they're a catgirl with an ultimate weapon/title
>>552095872uh oh lala melty
No cute femra at the orgy meet
>>552095861it's lukewarm
>>552094436https://www.youtube.com/watch?v=Z0mPs9MjZNA>>552095101>>552095693supremely based
>>552095814It's how they hunt. They just latch onto prey like a suction cup and waddle away with it, struggling and screaming, down into the tunnels.
>>552095915thread destroying post
>>552095956
>>552095901true and realso tired of the performative homosexuality in /xivg/
post orgy meet pics
>>552094436https://www.youtube.com/watch?v=Jgp6A7ru3zY
>>552095690do you like sunnie+?
>>552095923>guffy>dreiga>algygod damn now i wonder who you are because those+the ones earlier are all the worst people who were in there
Can someone invite me 2 da discord
>>552094436https://youtu.be/UIUDoaH_GtU?si=9zBKmhzdrJP_ZWdn
>>552095957Sis....
>>552095915everything is easy to learn except scholar and ninja
>>552095852You do not speak for the community vile immigrant.
>>552094528Because early Savage is rarely some super crazy puzzle fight that you need streamer solutions for. Can you think of anything in Dancing Green that you'd have considered a serious headscratcher that you need MrHappy to give you the solution for? Progtime is heavily backloaded. You can get up and do the first 1~2 floors (maybe start on the third) in one session, sleep, and then do as you describe and reference the super serious poopsockers who continued grinding.
>>552096064PA IM BREAKING INTO BALMUNG FOR YOU.
>>552095923guffy is that old?
Is it true bard is usually better than DNC during early in the tier? Why
>>552095901we weren't dating or anything close. you right as hell doe
>>552096062builded for big malezen woober
>>552095789Choosing an xivg orgy as the place to satiate your horniness was certainly a decision
Name a single bit of interesting midlander lore or history. You can’t. They are the most boring RPG race ever.
>>552094436https://www.youtube.com/watch?v=UVTGs7dYLDY
>>552095798What, like this?
>>552096138guffy is almost 40 bro
>>552095901IRL, I'm Harvey, a balding 37 year old accountant with diabetes. But in XIV? In XIV I'm Ava Catte, a catgirl with giant tits, and there's nothing you can do about it
>>552095716>>552095775>>552095852Tenks, may make an album one day c:>>552095921Sorry, best of luck with your plaps!
>>552095754i need full so i can jack off and pretend im spraying all over please please please
>>552096195where else am I suppose to go do they even have orgy clubs on non weekends?
>>552096213i want you
>>552096213akemi going through her hotgirl summer phase?
>>552094668>When you're so misogynistic you indirectly end up a trans ally
>>552096195You're right, I should be satisfying it with this femra instead.
need gam gf
>>552095638anon we're not leaving room for jesus in the equation!!>>552095646i will contemplate it.. or maybe make a new one..!!on an unrelated note the lighting in here is so dramatic it looks like im an interviewer asking some hard hitting questions
>>552096117I watched heated rivalry though >>552095754IN CIIIIIIRCLESSSSS
Akemi is an obese Black man with a micropenis
qrd on evra reverb?
>>552096340no smart man would want to be a woman after all
>>552094003Schizo
Log leakers are BASED
>>552096194That isn't a discord invite
>>552096293You just ask here anonymously or go to the bench like a normal lewd anon.
>>552096048mhh, i went by fugman for a while
>>552095715very BASED and cool>>552095809>shitters in pvpmy bad i went too crazy
>>552096039Depends on the sunnie
>>552095103I will find you now my future wife
>>552095901I'm SMOOTH shaven though.
>>552096213akemi owes me sex
>>552094665glad I didn't miss out
>>552096476Proof?
>>552096195catbox?!
>>552096095nta but>play ninja as my main>its pretty easy and i love it (despite it apparently not being that good but idc because i just play for fun)>tried scholar as my first healer>mfwmaybe im not cut for healer but that shit felt hard. ninja wasnt hard at all
>>552095125ok i'm sick of your conditioningi'm buying wc3 rn and playing with you
>You have to be on dynamis, or else you contribute to the problem!>Just stay on dynamis!>YoshiP please open up aether ;w; I'm tired
>>552096195Well, catbox those tits then
>>552096379my image didnt post what the fuck!!
>>552096437going to the bench is scary
>>552096379I shall await your post then
>>552094897https://files.catbox.moe/xxwgzv.png>>552094315Sunnie>>552094436https://www.youtube.com/watch?v=LtTO1HMGjqA
does anyone have that meme saved of "in case of emergency break glass" and has the new cute green dragon girl behind the glass?
>>552096549Ermmmm no way, this isn't /soc/...
>>552095915for DPS for me the hardest is Dragoon everything else is easier
>>552096195I would like a lewd pic of you to empty my balls onto
>>552096475Stop pretending to be interested in me.
>>552096135If you do that, I'll break you.
>>552096048oh and i tried helping lahti/lathi? with mch but couldnt handle his autism then
>>552096576The bench is much less likely to get you a schizo compared to even a meme meet up like this one.
>>552096635its a character.. in a game.. at least ask for pics of his in real life ass
Idt I'm gonna make it to the meet goon on without me
>>552095901what's the problem here exactly? women are about as likely to be 150-300lb and have hairy privates as a guy online so it shouldn't be about if they're men or womenare you assuming that the way people interact with others in public is what their GAM relationships consist of one on one? how do you know what others embrace in private
>>552096432>just take it lying down don't defend yourselfthis is how anti-leakers sound. even funnier these are from public servers
>>552096641>pretendingYou'll see
Does aetherpool matter more than character levels in potd?
>>552095814What...
>>552096641fuck off back to blue protocol maru
>>552096685Any recommended plaps for the bench?
>>552096269not the time or the place brother>>552096414YES oomf, thats what im SAYING
reminder Arando and Brando Peam, formerly known as Arando and Brando Oomfie, spent months griefing Eureka on Chaos and Light during Endwalker, leading to the collapse of Eureka discords such as Late Night
>>552096641why wouldnt someone be interested in you?
>>552095901I've talked with at least one anon who is an absolutely precious cutie so no, not every anon is a super obese 40 year old man.
My femlala is hairy
>>552096720same...
>>552096764sounds pretty peam desu
>>552094003Femezen pull off a lot of glams and are very cool/stylish looking but their fast walk cycle is terrible, probaby bottom tier alongside maleras.The sprint isnt so bad and the rp walk one is great, but the one you see the most is TERRIBLE.
>>552095775Sorry I'm about to go dc in PotD again>>552095852Thanks, it's rough out there fr.
>>552096557half joking because they're just the jobs i play, but i do think they're among the more complex jobs. and fun, they are really fun.
>>552096130>Can you think of anything in Dancing Green that you'd have considered a serious headscratcher that you need MrHappy to give you the solution for?No, but if I cloned my group and group A did dancing green server up and blind progged it to clear. And Group B waited 12 hours and watched a mrhappy vod and replicated it. Group B would clear in half the time or less.
Someone said my femlala looks like she would have a triangle butthole, what does this mean? Should I be more concerned than I already am?
>>552096712Where do you think you are retard
>>552096764fucking based lol
>>552095715Maliddiejeets wish they looked like that
>>552096474subby sunnies...
>>552096764they deserved it frankly
>>552096740I'd say no. I'd rather be under the floors aetherpool cap than underleveled, but with how potd works now you'll almost never be under aetherpooled.
>>552096559don't but it at full price its NOT worth 40$!
>>552096747who?>>552096756nta but I can recommend and warn you about people there unironicallynamedropping them here would bring schizo attention to people who don't even post here, but we can talk in-game if you want
>>552096869Sis... I have no fucking idea what they could have meant
>>552096760IT IS THE RIGHT TIME AND PLACE for me
>>552096428Why?
man its weird watching men cheat on their gfs in this game for xivg people
>>552096557I don't find SCH particularly hard.The problem for me is that its fucking skills don't fit well on any god damn hotbar you could possible set up. Everything is uneven as fuck. No matter what, something is going to be out of place simple because you can't stick it where it would belong.I've only gotten to 70 with NIN.
>>552095915warplddrkgnbwhmsgeastschvprrprmnknindrgsamdncmchbrdsmnpctblmrdm
>>552096824> Femezen pull off a lot of glams and are very cool/stylish looking but their fast walk cycle is terrible, probaby bottom tier alongside maleras.The worst walk is miera by a long shot. My femlala actually likes the malera bounce.
>>552096979I did this while getting mindbroken by someone's altWhat a time
>>552096882shut up mo fuyou are a fat hairy man irl
>>552094436https://www.youtube.com/watch?v=FlxmWQkhu2o
>>552094436https://www.youtube.com/watch?v=sqK-jh4TDXo&list=RDsqK-jh4TDXo&start_radio=1Am not even sure whose cum this is on the floor but i had to take a picture on it.
>>552096764the compilation of meltdowns they caused was hilarious though
>>552096824Femezen are like marble statues, very nice and graceful while standing still
>>552096738I've seen. Nobody is interested in me.>>552096771If anyone was interested I wouldn't be alone.
>>552094436https://www.youtube.com/watch?v=1t_NLQfIfso
>>552095915I took out all the classes i've never played and dont have unlockedTANK>gladiator | Hardest fucking class i've ever played
>>552096741I just KNOW these two kiss.A lot.
My malezen doesn't speak french when he's got his clothes on
>>552097113queue up doom train you stupid bitch
>>552096945it's only 30 though
>>552097104Need a picture or an archive pleaseeeee
>>552097114Good posthttps://www.youtube.com/watch?v=KBbiMZ0AQsI
>>552096095>TankWarriorPaladinDark KnightGunbreaker>HealerWhite MageSageAstrologianScholar>DPSViperSummonerPictomancerReaperDancerBardMachinistSamuraiMonkDragoonRed MageBlack MageNinja
>>552096975I'm interested but last time I gave it a shot with a xivger I knew nothing about it backfired and they turned out to be awful
>>552097113what if people just don't know you enough?
>>552097082You should lick it. And then swallow mine
>>552094568My femezen’s massive wobblecow slutjugs shall jiggle and slosh elsewhere then
>>552097160How many biological women are on this team?
so what benefits will we exactly get with your proposal of "everyone in the static wears a uniform glam for prog"
Someone should start plapping at the meet
>>552097126Based sprout giving the one objectively accurate ranking.
>>552097284it looks cool
>>552094436https://youtu.be/Mgcr8L9-Uc0?si=xOms0hgx3-YUGA9o>>552097037Firstly, wrong. Second, wrong again! Thirdly..If I wanted to call you a retard, I would call you a retard with my silly cat attached, retard :3
>>552097163wait for a sale! there's gotta be a better deal. I love wc3 but that's a fucking scam pricet. preordered it when they announced itI can't in good faith say its worth buying at full price even with how much they've actually fixed it
>>552096824>their fast walk cycleYou mean the run or the sprint?
>>552097252Literally 0. That's the most tranny lineup I've ever seen.
>>552096593this pic goes kinda hard
>>552095915This is a little hard since some of these jobs are easy to pick up but hard to master and vice versa.>TankGNB (harder to pick up, easier to master) >= DRK (easiest to pick up, harder to master) >= PLD > WAR>HealerSCH >= AST (harder than SCH to pick up but easier to master) > SGE (harder than WHM to pick up but easier to master) = WHM>DPS, meleeI essentially don't play melee so I will omit my opinion on these.>DPS, casterBLM >= PCT = RDM >>> SMN (kinda fight specific IMO, I find optimizing burst on BLM/Leylines to be more difficult than RDM/PCT overall)>DPS, rangedBRD >= MCH > DNC
>>552097162I don't have the item level, and I wouldn't do it anyways because you're being rude for no reason.>>552097217Nobody is interested enough to get to know me.
i stopped talking to you because you are boring and everything you ever speak about is ebins and "did you see slorpo cheated on morpo"
>>552097163Why the FUCK don't you play Broodwar instead?
>>552097160I miss me hermanos...
>>552096764pretty based tbqhwyf
>>552097284I only made this mandatory when we faced Honey B so that it would look like her fans were kicking her ass
You haven't sent me a discord dm all day....
Is there a plogon that track the pot timersBocchi doesn't have
>>552097324My lalaboy is available but the ladies just can't handle him...
>>552096556>>552096563Best I can dohttps://files.catbox.moe/usz5qk.png
>>552097427I know.
>>552097369no reason to be interested in a someone that doesn't have a personality
>>552097384because this anon wants to play wc3 custom maps >>552097360
>>552097427how about you send me one
>>552097369I'm interested in knowing more about you right now though that's why I'm asking about you
what is the "the use of a shotgun was considered a war crime by the germans in WWI" of frontlines and crystal conflict
>>552097468looks like shit
QRD on jorosh eventide? does he have bwc for my femezen?
>>552097427ayumi please stop
Trying to get the Bunny Blessed title, I think I need another Miera on the other side for it to work though...>>552094436https://www.youtube.com/watch?v=9u7hGkL57N8alternativelyhttps://www.youtube.com/watch?v=W60IPexop30Been on a kick recently
you know for an orgy... there are too many people with pants.
>>552097249hm.. proof?
>>5520972521. GAM2. GAM3. Turbo-tranny4. GAM5. GAMI count 0.
>>552097347you are also a fat man irl
>>552096298I'm not available>>552096329I'm actually phasing into my coldgirl winter quarter>>552096514I can't afford to pay you back anon...
chat my gpose wont let me change the roll angleregular gpose options, brio and ktisis don't let me do itplease send help how do I fix this?
>>552097583turn off POV mod
>>552097468Nice.
>>552095125Where?
We literally used to have actual lewd meetups before dalamud was a thing but nowadays we can't even get that right when we have all the goontech in the world/xivg/ has fallen
>>552097583Turn off your POV plugin
>>552097468take it off...
Anyone on crystal want to run roulettes? I got a pf under A.B. pass is 7894
>>552097468SFW shit, wasting catbox's storage space with nonsense. Do better
>>552097565Nyope! Good projection though! Don't forget to do your daily yoga.
>>552097369did you win your house, tokiposter?
>>552097543Use heels you bum
Link to pov mod?
>>552097468Cute, id marry
>>552097492Its true I LOVE custom maps. especially the super wacky ones or really in depth ones.>>552097652idk i'll show up anywhere as long as someone actually join my wc3 game
>>552097369>My personality is no ones interested in meOkay tell me about yourself>Yup no ones interested in meWanna hangout and talk?>Just no ones interested in meGee I wonder why no one wants to talk to you.
>>552094436https://www.youtube.com/watch?v=c3PfM2AjQ6g
Is Monk or Ninja more fun at max level?I do not have the god damn time to get both up there right now.
>>552095367I'm on Halicarnassus too. If you get in, let us know how it is. I might try as well.
>>552097658What more is man to want after walking out of a buffet?
>>552097519summoner
>>552097701this
>>552097548I'll start plapping but don't want to be the first one
>>552097697Why? I'm comfy
>>552097773I like both, I think ninja flows a bit better but I have way more high end prog hours on it
am I supposed to like Brando less or more now I'm not really sure
if it wasn't on balmung i'd be there sexpesting
>>552097773mnk has more interesting filler. nin has more hectic burst. pick your poison but i like mnk more
>>552097643>>552097665i love you both so much it's unreal
>>552095915XIV jobs aren't hard at all, they're extremely intuitive and if you just level by spamming dungeons that slowly progress your job levels and give you new skills at a dripfeed speed then you'll have a really good grasp on how to play that job at level cap. So are they hard to learn? Fuck no just stop relying on shit like bozja to level up and you'll learn your 123, press ogcds and press your goddamn buff skill before you burst.That said, are they hard to play? At what level? Who is this question directed to? Raiders? Casuals? Parsetrannies? You can play the job to its 90% of its capability and still be a grey shitter because you can't keep uptime for shit, some jobs like healers can't even be trusted with high logs as skill because that usually involves a really good party for rdps (AST/SCH), just not fucking healing (WHM/SCH) or just bribing your co healer to soloheal while you spam 1211111111 the entire day.
My femlala was raped at the meetup...
>>552097773Ninja is aids on modern content, Monk too for the very same reasons but they get punished slightly less for shit uptime.I enjoy monk more but my nin friend swears mnk is super unfun so it "it depends.jpeg"
>>552097113Have you ever considered that the kind of person you would want to be into you is the kind of person who would be interested in you after getting to know you and not just seeing your femra? If you just posted your femra and went "okay now I'm gonna wait and see who's interested", the responses you're going to get are generic "cute femra sis" replies and thirstposting, and neither are how you meet someone. You have to actually go out there and talk to people. Go out there and do it, pick some game mode or kind of content and do it with people. I met all of my favorite people here from RP events and CC, for example.
>>552097468Do you erp or goon?
Can we get the mung some mucinex?
yeah I'm just going to bed, even if someone does plap, I'll wake up and see someone getting shizod because Bling Blong fucked their crush Bleeplo
>>552097773The answer is to play Dragoon or Samurai. The fun melees that don't get fucked in the ass for missing a single gcd.
>>552097860Their goal was to make you like him less but they forgot he said those gamer words in thread already with his character attached, so...it did nothing, at all.
>>552097551They travel further afield to greener pastures where my cowezen may live happily
>>552097249good, get those obscene milkbags out of my face
>>552097369After i'm done here with content ill check if you're on the meetup and find you tokiposter, then we'll get to know each other more and more
I always forget goblet has the really long dark rape tunnel
Even in a fantasy world, you guys are impotent masturbators. Sad!
>>552097957Lol
>>552097347Mo Fu you are a skeleton at "best". A useless, unemployed leech that survives solely based on the charity of his parents. No wonder you're so mentally ill. A lot of your former friends have interesting things to say about you by the way :3
>no one even flirting at the orgy meetlame im outta here
The more you leak the more based this guy sounds not gonna lie
>>552097395stupido, los hermanos viven tu corazon
>>552097947BLING BONG DID FUCKING WHAT?!
>>552097957>Missing a gcddragon gets fucked REALLY bad if they miss a step on the 1-10 because they lose the dot and the dmg up what are you talking about
>>552096764https://www.youtube.com/watch?v=L1ZuTjqEX98
>EVERYONE jacking off in the corner
>>552097880np anon
>>552097896I should have done that but tuna was on a roof away from everyone else
>>552097957you clearly have never played sam
>>552098059Missing a single gcd from downtime, I should say being forced to use a ranged attack
>>552097557They're all trannies now btw.
>>552098087just need someone on their knees in the middle of them all
>>552097971then bring them back wtf
>>552095443If I knew Hoghagmi was gonna be there I'd have shown up
>>552097693No.>>552097908I posted my femra and nobody said she was cute or thirstposted.
it's too hot!>>552094216yes?>>552094436https://www.youtube.com/watch?v=EwtHt9Qe8tU
>>552097179That songs tuff. You fw Asap ANT? His stuff hit or miss but when it hits oooo! https://www.youtube.com/watch?v=8AErbnJKUq4
I think that tonight we're going to Think about this cat.
>>552098019Stopped reading at "unemployed" because I do infact, have a jobGood try though :3
>>552098000Plapped so many people there
>>552097969
WE ARE /XIVG/WE CARRY THE FLAME
>>552098000Meet my malera at the rape tunnel
>>552098127>They're all trannies nowIt's way too funny now knowing who one of those GAM was
>>552098000yeah you never know what's down there
>>552098179Once a week isn't a job, you little schizophrenic melt :3
>>552097773can monk(eys) do this?
>>552098167i dont think i will do that at all
Someone post the washed up catboy
>>552098032qrd?
Are there any maleroes at the meet up
>>552098138next housing lottery, hopefully!
the jar gains another victim
>>552098214Wait what happened I just got here, I hate to ask for it but. qrd?
>>552096893so true
Good meet, I implanted so much cream into people.
>>552098225hope you like malezen
>>552098283
>>552098138what does your femra like?
Who should plap at the meet? Post your OTPs
I'm finna leak
>>552098245Oh yeah, the pipeline is relentless.
>>552097013i would literally agree with this entire list despite two things.literally switch sam and mnk, and im not even kidding thats my exact list. sam isnt hard at all, mnk is the most challenging melee dps
>>552098272>he's not up to date on the infoHow you gunna do this and not do it right?
should I just come to the orgy and start raping niggas?
>>552098360i'm on that sigma rapeset, all are fair game
>>552098165Yeah ANT has some good songs, everyone in ASAP is better than Rocky.He was carried by SGP's production and his facial structure ngl. I miss those times though, everything sounded good.https://www.youtube.com/watch?v=ZiszYrWRcpQ
>>552098343stop being a retard
i ama male moonie
>>552098352I need to implant cream into your boyhole
>>552098214>marieroseRAPE
>nobody is plapping at the meetup!>where's the orgy???this is the whole goblet right nowname a single xivger who'd actually plap in front of the rest and isn't a lalafell
i think picto is harder than blackmage
>>552098138Maybe it was the time of day or the thread was moving fast? If it's something you feel avoidant or shy about it's pretty possible you posted it during a time it wouldn't be observed by sheer reflex. I'd offer to maybe give you some glam advice or tell you something like "that hair color and skin color look goofy together and the facial tattoo is a bad idea" but I seem to remember you don't want your tokiposting identified with your character, and that's fine. I just hate seeing someone sad.
I would've bred Katrina Ostward in front of everyone but I'm busy tonight...
Does your WoL freebleed or use a diva cup?
>>552098032Leakers and schizos dropping things about people always makes the person they are leaking about look betterIt's fucking hilarious how it never works
>>552098490I think ketchup is spicy
>>552098352Our buns need to frot. It is an imperative.
>>552098339tits and ass
>can't get onto balmung on mainWonder if I should try sending my level 18 alt to the meet
>>552095983thank you :D and excellent song LFGGG
>>552098442Hard ask, but still want to know what happened
>>552098486>muffy mog is theremaybe I should show up...
>>552095443HHM I am pending trying to follow your secondary twitter can you approve me please...
>>552098486Ayo? Ace is there? God I want to take her to a sunning rock and plap her brains out
>checking discord leaks fron last thread>the most abhorrent posters ALWAYS have some tranime pfp Literally like clockwork. No man with a pfp of some anime girl has ever deserved to live. Genuinely makes me sick.
I would plap anyone at the meet infront of others you just have to ask
>>552098486Ace Le'fayJorosh EventideMuffy Mog
>>552098486Yeah I don't have any characters to plap but that's why I brought out my executive cuck chair
ATTENTION ALL SINGLE FEMALES ON CACTUAR.THE LOVE OF YOUR LIFE IS ONE /TELL(POSIBLE FANTASIA) AWAY
>>552094436https://www.youtube.com/watch?v=2QLknKasSIg
>>552098443May I see him?
>>552097669But it's cold
>>552098606ace is lala now
>>552098532Well not necessarily. Im pro leaking if it exposes wrongdoing. But nothing this guy is saying is wrong.
>>552098523they really gotta stop recycling the demon wall boss
>>552098273Based
whats a GAM>>552098245
>>552098626ace is a lalafell anon...
>>552098669SHOW THOSE FUCKING GOODS NOW
>>552098620>calls others trannies>wants to read up on all the hot discord gossip
>>552098630Can you ask him if he likes... ah nevermind...
>>552098630>im fieraFUCK
>>552098486>Who isn't a lalafellDamnit
>>552098365literally me
>>552098630cringe
Mo Fu is fucking deleting this dude and it's great.
>>552098590hea banned from their FC house so it's funny he's at Arando's private estate
>>552096760JUST POST THE ALBUM YOU FUCKING WHORE I KNOW YOU DONT HAVE SINGLE IMAGES
I know people are busy trying to schizo post and stuff but since I asked last time and it sounded like they were mostly dead, is there any interest in a general extrachat again? I'm mostly literal who so I'm not expecting to be joining any semi private ones so was thinking about just trying to get another mostly anything goes public one going again.
>>552098486>orgy sounds fun and interesting in fantasy>in reality its all creepy shitposters and people you woudn't want to plap or even want to see plap
>>552098669Not gonna lie, starting to regret not showing my cat to this femra yesterday...
Why do you guys always hide the shit talk in private channels/private Discords though
>>552097878I think I prefer slower filler and more hectic burst based on that.I really am not entirely sure though. It's hard to judge when my only real DPS job is Black Mage.
>>552098784why is he banned
>>552097215Idunno just send me a tell if you feel comfortable with it or just form an opinion from the archive
>>552094436https://youtu.be/7NCtXJPcxOk?si=AmKMVX7uBBEMTPOe
>>552098352yea thanks bruv
>>552098691>>552098710>it's realI'm going to kill myself
>>552098776Huh, what did I do o;
>>552098626>Ace Le'faylalafell>Jorosh Eventidesome inside joke I assume>Muffy Mogwouldn't>>552098796we lost the real bikes...
I love this game.
>>552096656is that a threat or a promise big guy
>>552098443a maloonster, some would say
>>552094153https://files.catbox.moe/1zqodq.png
>>552098830They wish they could be as based as Sera
>>552098830>Say something bannable ingame so I can report you
I dun goofed by thinking this meet would go anywhere. Back to ASMR in bed, it's a more productive use of my time.
>>552098691Will still cum inflate to bursting
>>552098669damn I didn't know this femra had em like that. more?
>>552098851Talk with him for a week and get back to us
>>552096213>>552097576>corrupted AkemiThe worse /xivg/ gets, the sexier Akemi gets.
>>552098912you mean the guy who spent like 3 years pretending to be his sister?
>>552097730it's gonna take a lil bit
I'm not a coward, but I couldn't get onto balmung...
>>552098917seriously, what a waste of time
>singular D-word is now auto banned (the only time I have ever seen a video game term get auto banned in my 20 years of using this site)>fresh ERP/GAM drama>a literal orgyI take it this isn’t a good time to resub? Was 7.4 really that bad?
>>552098214lmfao I told people that little cabals of people that follow you around and try to mass-report you for naughty language were real. Same shit happened to me, except they were communists, not french.
>>552098851ask Brando
I could've saved the meet.
>>552098386of course you would agree with me, you're me... but i will have to disagree on monk though, it's WAY easier to play at a basic level now while sam has to pay attention to hinganbana still even though you have a lot more freedom with tsubame becoming unrestricted
>>552098842Then nin sounds up your alley ^_^
>>552098851he made brando mad
gogmazios fucking sucks>>552094436https://www.youtube.com/watch?v=BEhlYL8ev18
>>552098915Say it in the thread with an avatar then lol
>>552098949She wears clothes that compress her chest a lot.It's one of my favorite thingsBut no, sorry. That's as far as I'll go sharing public images.
>>552098494Everyone else who was posting their character got replies, mine went totally ignored. It wasn't just a fast thread or a bad time.
>>552098964I'm in no rush.. if we could just find ONE more person we could play sunken city... it kicks ass..
>>552094436https://www.youtube.com/watch?v=39jIjmYl5e4
>>552098786i dont have an album and im not making one you dumb negroidgo look at the twitter account if you really want and no im not going to link or shill it Fuck You im not spoonfeeding
my femra just took her meds and is already getting sleepy....
>>552098980doesn't take much to get a term banned, just spam the entire site with it
>>552099019Damn, so Omega's still king?
The croc has breached containment
>>552098486Also I don't erp so it'd just be the emote, but I don't have the emotes
>>552099023Anyone can fake those by just saving someone's images
>>552099002>>552098965Same xisters... my cheeks remain unplapped.
>>552098885actually fucking ruined even though I like the lalaglub for years only to change to THIS
>>552098563Menphinas earring is easily top 5 earrings in the game, azeyma's isnt as pretty.
>>552098917>>552098968Just go up to someone and ask to plap we are all waiting for someone to start it
>>552099019Wilds sucks.
>>552099065Wanna drain my balls?
>>552099145What if we had our own orgy
>>552098620#of maidens fucked: 0#of trannies saved: 0#of niggers given a job: 0
>>552099079My femra may have gotten stood up tonight and she might take a bunch of her meds too so she gets the big sleepy and forgets about the lies that were promised to her today
>>552099115https://github.com/Aspher0/BypassEmote here you go bro, sadly only works with lopsync
>>552098980Tonight's a great time to resub because you'll need a few days to catch up and be ready for next Tuesday's AAC Heavyweight (Savage) release.
>>552098980>I take it this isn’t a good time to resub? Was 7.4 really that bad?the thread is literally 95% gams erping and drama around who erped whothe other 5% is ppl talking about the game but they get ignored
>>552098917Who do you listen to? Actual asmr or the goon stuff?
>>552098950i have and i still dont understand. a little autistic and quirky maybe but came across as harmless and not worthy of banning from anywhere
>>552098343arando and brando broke up and arando already moved onto someone new at the orgy while brando is not even at home
>>552099213I don't even know what this means anon
>>552099072alright someone else give the name then>CRICKET CRICKETi rest my case... i've won. nobody puts out here anymore... what's the fucking point
>>552099197I think me femra will do the same...
>>552094665I tried sharing the link so people at the plappy club could watch too but I'm considering on doing an encore since there's people who missed both and wanted to see them.
>>552099096i don't like gog but omega was the most miserable experience i've had in monhun>>552099163well yea, kinda. at least i get consistent 120 fps now after the update.
>>552099087>the entire siteThe thread had one (1) instance of a plural version of the word spammed months ago. What is Good Smile Company even trying to accomplish? Is FINAL FANTASY XIV: DAWNTRAIL really that controversial of a game?
>>552099197What happened, sis?
My fiddie got zero replies or tells in 2025
>>552099213why sadly? is lop not what people use?
>>552099043One bizarrely common phenomenon is that really cute characters go unresponded to because people who would normally thirstpost go "oh she's definitely taken already".
>>552099197umm... as long as you only take what the doctor suggested...... it'll get better sis, new year new you(soon)
>>552099079my femra is considering weening off her melatonin gummies because she just throws a bunch in her mouth which makes them work but she feels tired throughout the first half of the day
>>552094436https://www.youtube.com/watch?v=8WBqzFVrENQ
>>552094216the xivg community thanks you for taking one of the team and getting together with muffy
@552099341it's gonna be the same in 2026
>>552099341Hell yeah sister, you aren't alone
>>552098798It's never too late
i like summoner
Why havent they made a good looking relic weapon for White Mage since Nirvana in ARR?
CCcrystal1:00 ETcalling from the wandering stairs on malboro if anyone wants to hang out a bit
>>552099018>>552099000qrd???
>>552098980>singular D-word is now auto bannedQRD?
>>552099163TRUKEworst MH they've ever shat out
>>552094436>>552098563it's up there with the greatest of all time tbqhand cliche pick but so is this one (though only the versions with the full bassline) https://www.youtube.com/watch?v=LhLmgg_u29k
>>552098980No reason to resub unless you want to jerk the fuck out of your throbbing cock and cum all over the place including yourself
>>552099391Still shy to do so here sorry, as I said, may end up somehow finding you in-game
>>552099363That sounds like very strong cope.
>>552099397can I plap there? nobody is plapping at the orgy meet
>>552099378for real? qrd?
>>552099465why don't you go back to *you know where*?
>>552099471taking lilsi in there and expanding the coating to the walls
>>552098885>>552098691Didn't he used to spam that one drawn femra image like "good morning i hate lalafell"
>>552099396the armor and weapon designers do not give shitname me one legendary glam that people go crazy for in this game
>afk for 5 minutes>lalafell is looking up my femra's skirt againSIGHHHHHH
>>552098980The game isn't terrible, but /xivg/ currently is. The cast of characters suck, we need a Great /xivg/ Reset.
>>552099341Post her, im looking for a fiddie wife
>>552099276Be safe anon>>552099326IIIIIIIIIIIII don't want to talk about itIt's actually not that bad but it could be bad because of why I may have been stood up>>552099367My femra does not listen to her doctorBut yes, new year will be my year for sure!
>>552094153https://files.catbox.moe/lrpvpf.png
just come to dynamis if you wanna get plapped, it's so easy
>you went to an orgy>a digital orgy in a video game>you went to a digital orgy in a video game and were too much of a pussy to have digital video game sex
>>552098865Oh sis are you online right now? i've been meaning to ask you something
>>552099452I was at the spooky meet earlier like I said! Shame to have missed you...
>>552099549really?..
>>552098980Okay that shirt kinda fucks thoughI wonder if I can find a good washed out version of that VHS cover somewhere
>People find this attractive.
>>552099518https://arch.b4k.dev/vg/search/image/e8Tqai75VAU13TqqZdz66g/this one
Good night, I hate lalafell so fucking much and wish every single one of them in existence and future existence die a painful and slow death
>>552099547*embiggeringray*
WHAT THE FUCK IS A GAM YOU NIGGERS
>>552099547DO YOU LIKE CATBOYS
>>552099152it's the only one she's worn since i got it basically right when i started the game because i agree.. it's so pretty>>552099438listened to this on really good headphones at a radio station i used to work at a few years back and it changed me forever man
tfw still no dynamis fc
>>552099549With a population of 8 on a good day, isn't that illegal with all the inbreeding?
>>552099197Akemi...
>>552099507I don't know where.
>>552099396ah ah ah anon!! i dont think so!
>>552099595No....
>>552098980I honestly can't think of whatever term you are referring to so I'm guessing nothing of value was lost. I wouldn't mind about half a dozen other terms being banned though.
>>552099521Sure but there are SOME good relics for other jobs, maybe its just hard for them to make staffs look cool, but I mean Black Mage even has some decent looking relics. idk
Is it possible to seperate your party's debuffs with your own and place them on entirely different parts of your screen?
Good to see it was a nothingburger meet after all. Me? I'm getting in the wage cage again. Wish me a good night y'all! And try not to burn the place down while I'm not here.
>>552099564I don't have sex emotes anon
>>552099676aren't you looni?
I want to reach out and touch my fellow anons.... but they're so far away.... locked on Balmung.
>>552094153aint big but since its today why the heck not https://litter.catbox.moe/psicff7rsahm5kvm.png
Should I make some brownies from scratch or try to find a femezen to erp with
>>552099623making PD wear an oversized version of this and everytime she walks by I flip it up
>>552099760she looks like she fucks catboys
>my crush has his RP tag on at the orgy meetup
>>552099652It's old timey slang for legs
>>552099797It's over..
>>552099760I knew I had good taste in sunnies
>>552099760Does she like sunnie+?
>>552099675Shut your face nerd.
>>552099572Yeah I am, I'm on Aether right now. If you need me to I can hop over to Crystal though
>>552099736I don't know where that association came from and I have no idea who that person is.
>>552099246I think it's just someone trying to start shit.
>>552099147It amused me to run around as this gremlin. I'll probably get bored and fanta back though>>552099518>>552099638Nope! Loads of my good friends are lalas..
>>552099197Can the arms of my big strong malera ease your wounds...
>>552099249and arando's plap buddy is leaking everything from their discord
>>552099797I'm plapping your crush rn lil gup good luck next thread crush(I've probably already plapped em anyway).
The last person to reply to this post gets 100 million gil in submarine vendor trash
>>552099859oh damn. you really should use different pictures to avatarfag with lol
>>552099797oh yeah menzenchin is a huge whore
>>552099471Just because she is cute I would trust her and walk the other way.
Any fatras?
>>552099760this is nice. please dont be gay
>>552099760Hot. Wanna help me cum?
>>552099910I shan't be posting mine
>>552099846eb status
>>552099729I mean he's not wrong
>>552099542Why, sis?well whatever, it's his loss
>>552099870the only glubra to make green look goodi always said hi whenever you were doin hunts... even before i knew you posted hereeveryone fucking posts here man
>>552099760holy meowly
Does /xivg/ approve of my femezen?
>>552099892My moonie would throw away the items
back in SHB when /xivg/ was still good there was a wide variety of hot male character avatarfags to lust over. coincidence? i think not
>>552099729you can stop reposting your messages here brando
>>552098917Goon stuff but usually longform audios where like there's a relationship or a confession or something like that before it gets to the lewd stuff, maybe some aftercare when it's done.
>>552099785honestly yeah, I'd wear it
>>552099907He wishes, but the only time he can get a femlala is out of pity when he's sex pested them on Discord enough.
>Ace is a lala I'll still love my (soon to be she just doesn't know it yet) wife...
Light is cancer thoughever
>>552099719ummm, i'm not sure i understand the question exactly but check System->HUD Layout and go read through the UI element Settings for Status Effects.
>>552099848If its not too much trouble i'd like if you can hop to crystal. Im in an instance right now but i should be done in 10 minutes
>>552099729So far all ive seen are truthnukes from this guy
>>552099678please let me lick your staff
>>552099846..my bad sis
why is nobody plapping?
>>552099997https://x.com/ObsoleteSonythis guy sometimes posts sales of shit like that
>>552099984yeah sure
>>552099652it's short for gammy, aka grandma
>>552099846This all could have been avoided if you had just EB'd a catboy
>>552099996Hey wtf i've recorded stuff like that for people before...
>>552099373top moonie with based taste>>552099658>it changed me forever mansame, hooky literally made me pick up the bass even though I knew shit about music>>552099729you're just making him look good
>>552099870fanta back now
you always on my mindwhen i ride through the eastsidei wanna see youuuuu
>>552099996Dumbass didn't respond to the right thing.But nice, I have to use kemono for a lot of it myself because anything good is usually hiding in patreons.
>>552099736What are you talking about?
>>552100093its him posting the logs
>>552099910my femra looks like this irl but has a vanilla body in game
i can not believe phil house is at the orgy meetup
>>552099996https://files.catbox.moe/a63eer.mp4
>>552099984idk lets see her with less clothes?
>>552099870Can you put in a good word for me with chi or sun..
>>552099652GAM=Grown Ass Men. Usually used in a derogatory way to refer to balding obese men pretending to be catgirls online
my crush got plappled at the orgy meetup and sent me the logs...
>>552099984Ill need to inspect in game
>>552094436https://www.youtube.com/watch?v=w_os8HqfxHci got the wings!
>Show up to orgy meet>Nobody is plapping
>>552100137go away nigga, i wasn't talking to you
>>552099984My Highlander gives a thumbs up.
>>552099910the only fat thing about mine is her chestI wonder if people into idealized fatties like that body tend to prefer slim hands/feet and neck/head or if there needs to be a certain amount of fat there to not look like a copout
>>552100180my femra is like this
I use GAM in a complimentary way
>>552099870real ace fans will fuck Ace as a glubra or a glubafell btw
>>552100263post fat chest
>>552099980Just walk up and say hi Anon!>the only glubra to make green look goodI'm sure there's more!>>552100112It still activates my neurons sorry Anon, the gremlin will continue to happen>>552100173Just talk to Chi, Chi is nice... They won't bite your head off..>>552100015what da
>>552094436https://www.youtube.com/watch?v=6yy-Es6rp3U
>>552100284Thanks love.
>>552099760are you coming to the meetup?>>552100230they left here to plap, then
>>552100018like i want 1 set just under the boss hp bar but i also want my dia in a different area closer to my character does that make sensemaybe you cant do it without plogon
>>552099652Great And Marriable. Watch out for GAWs though(Gross And Worse)
>Otis
>>552099987Hey...
Hey guys i have an idea. So we all know the part whre you can go in the cerebus's belly in the world of darkness raid?Square enix clearly has the technology to make next expac's raid in sphene's belly and any time you escape she just eats you again because your tiny little shrunken character belongs inside her forever.
>queued CC on ranged for the first time in months>PLD WHM on the other team and we get absolutely crushedmy fault>>552100284i use it to describe myself ironically
>>552099652Grown ass man. Fortunately My f3mra doesn't fit in this category because she is a GAN
>>552100309denied, I'm actively falling asleep and typing is hardgoodnight
>>552100295Noooo lala is not for lewd, lala is for running around to spam WAAAH
>>552099889*breaks your neck*>>552099907wtheck no he's not...
>>552100369spheneo wouldnt do that shed protect me
>>552100408Grown Ass Nigger?
>>552100436goodnight mysterious milk truck femra
>>552100408Getting A Noose?
>>552099987I unfortunately have better things to do than take homoerotic pictures of my character all day.
>>552094436https://www.youtube.com/watch?v=aa-J1RavYTI
>>552100408I DIDN'T MAKE THIS POST
Did anything cool happen in 7.4 or is it still dogshit? I noticed Y'shtola is back. Did she investigate the properties of the cum chalice?
>>552100092It's not really fair to say this and leave it at that...>>552100124Dun goofed again and HOLY SHIT they fixed the fucking uploader I cannot believe this thank you for reminding me to check.>>552100167Never seen this one before and I cackled, good job.
>>552100408Grown ass nigga?
>>552100230sorry sis
>>552099515i dont wanna go back there....!
https://x.com/DaenyLove/status/2006103684732596714Stuff like this looks so good but then you realize to accomplish it you gotta put all the items of a large plot into a room the size of an apartment
>>552100408>>552100512SS POST!!!
>>552100248What? Yes you were.
>>552100030I'll be in Gridania on Goblin for when you're ready
>>552100180Self-report.
>>552100347ohh, damage over time debuffs. no, you need plugins to organize them like you want.
>>552100313name 5
>>552100458>she hasn't seen his f-listoh no sis
>>552100346yeah, she did>>552100537im not complaining?
>>552099987Forget the hot part, do we even have any male ebins left from those days?
>>552099596Yes, really. My BFF, who's a femra, goes to dynamis and gets plapped on the regular.
Need cute nonra....
>>552100237*eats your ass* in a nice way
>>552100516We went to Krile's aunt's house and suplexed a train. That's pretty much it.
>>552100580Ummm.Statistically they exist! My femra can't be the only femra to have a nice green glam!
>>552100549SHUT UP
>>552094436https://youtu.be/5fNhD_lP1F4?si=HQUL02h9fTE0rdYWOnly found this today but really enjoyed it
>>552099652gay asian male
Reminded why I keep shout off
i cant wait for everyone to leave the meetup so i can plap my threadcrush
>>552100610freaky sis...
why should I care about any of these discord leaks, nobody involved puts out
theres no one in here...
>>552100531I can't post it here, I raid with people from here and I would literally get roasted alive
>>552100652
>>552100715this is the correct mindset
>>552100643can you even name one....
I'm kinda leaking rn....
>>552100706Is it her?
>>552094436https://youtu.be/jozqnG_32i0?si=vtkogClZFjU7eLFZ
>>552100772go to the bathroom, you are shitting yourself
>>552100712what...
>>552100516wuk is doing some training exercise outside of turalcalyx will be gone by 7.5 kuja fightthis smelly moldy foid femra ascian who majored in plants is a boring quirky chungusugly bastard malezen is in charge of speen.
>>552100772Sis if your incontinence gets any worse...
Anyone at the meet wanna plap?
>>552100772dont cry sis...its gonna be okay
wish that blue cat would EB me....
The worst thing about waiting all this time for Beastmaster is that it will never be as good as I want it to be.
>>552100496post your malezen or catboy so i can rapepost him right NOW>>552100613not really... i miss grillcat the most
>>552100748gross
I would go to the meet but nobody would ever plap a sprout...
>>552100715brando found out arando was trans and dumped her and then arando got together with another thread tgirl
>>552100814>>552100834Bout to drop some logs...
CCcrystal6:15 ETsorry was sampling one of the cookies i made
>>552100629>>552100819>ugly bastard malezen is in charge of speen.Looks like we're going the ugly bastard route then. Sad.
>>552100613theo...
>>552100771Umm.Mlems away silently
>>552100852I am very curious to see how they gonna ruin it because there's no way they make it work like in XI
>>552099987>SHBwere there even mods to make male characters hot?
>>552100816whats up sis?
>>552100879I assumed both were trans though?
>>552095915Of the ones I've played RECENTLY>BLM (I can play this one while high or drunk, can't say the same for the others. Easiest of anything I've played)>Machinist (piss easy but not as easy as BLM)>Reaper (Rotation and bursts are extremely easy to fuck up due to how clunky it is and how I tend to just suck at melee, but it can be fun on occasion)Of the ones I've played, but not for a long time (inherently lower due to lack of practice)>Bard (Haven't touched it in a very long time)>Samurai (last played in EW, was filtered by it early on)>>552099626I don't but I like the reptilebeast because it's so unique. You rarely see fat male modbeasts, let alone scalie ones.>>552100879Is this actually the case?
I am a femlala who is masturbating in a venue alone because nobody there wanted to talk to me...
>>552100875I would
>>552100956drinking wbu
>>552100975neither are that anon is just trolling
>>552100875I would... But nobody would ever let a lalaboy plap them...
>>552100998Which venue, because all the ones i've seen don't allow lalas and i'd like to add more to my list of lala friendly ones.
>>552099779make brownies sisim too tired to erp
>>552100937It's just gonna be like current summoner where your pet is just an attack animation.
>>552100945all we had were the basic The Body nude mods and that's all we needed tbqhwuf modbeasts are a turn off
>>552100613Yes. I'm one.>>552099987You're delusional. The other males here are genuinely pretty good looking.>>552100945Yes. Not as many but yes.
hey guys can you give me a qrd because i'm a tourist who doesn't know anything!
>>552094153>>552094315
>>552101076ill get right on those shirtless tbse screenshots then
I want to plap Ruri Tora at the meetup, I'll even put up a poal with some animation options
>>552101076God I love it when Malera turn on the TBSE-X and Zweihander...
>>552100764YES YOU
>>552101001about to sleep methinks, have new years eve stuff to do tomorrow....but ill drink when i got out to some friends
>>552101025but they're catgirls that have the dawg mod on, so they gotta be...
>>552101151</3
>>552101129Sure man, what do you need a QRD on?
>>552101025>>552100980>brando posts that arando came out as a trans>arando is seen flirting with known thread tgirl that does t4t
>>552101058Not telling you. You just want to leak it so the owners will get harassed by the weeaboo police.
>>552101126>not as manyinstead of 3 there are now 5
>>552101076If you wanna meet, my highlander will take his shirt off for you
>>552101131Sad I can't "bigger" post this cat anymore, but still a cute
>>552101131this lacks sovl
Name 5 plappable male ebins.Pro tip: you can't
>>552101129https://files.catbox.moe/z5a2jy.mp4
>>552101167Not all dog ear moonies are trans
>>552101043DYLLFERPCIHPAEC???
>>552100478>>552100536Yes>>552100512>>552100549There is another
>>552101192ok my bad
>>552101058I'm in the Respite Bathhouse Mal/Mist/W25/p52
>>552101146zweihander?
how is moonie formed
>>552101249m-me
>>552101129Yeah, we love trans people!We hate bigoted chuds!Racism is a big no no!Hope this helps!
>>552101131Catbox? Wanna nut on that
fulala for my femlala
>>552100531Anytime. hope you find some nice stuff, I wish I could ask for recc's.
>>552101305Oh cool, I didn't see that one. Time to go peek.
>>552098709GROWN ASS MAN (now tranny)
has Brando even posted during all of this
>>552101318When you rub two braincells together hard enough...
>>552101249This fucking twink slut >>552101250
>>552101260news to me
>>552101304np g
>>552100546It's also really cramped once you go inside it yourself.
>>552101318They fall from the sky as shooting stars during a full moon
>>552101126>The other males here are genuinely pretty good looking.but they barely fucking post is my point. the thread is a fucking futa sausage fest these days and i'm sick of it>>552101136good... i'll be waiting <3>>552101239i don't meet up i just lust from the thread but i promise to give you (you)s king
>>552101312https://www.xivmodarchive.com/modid/142945It's peak because there's also a condom for ithttps://www.xivmodarchive.com/modid/150283
>>552101231He can't do anything now because of the barring thing. He got extremely pissed off by that and that's why he makes more alts to shit on Leviathan with
what the helly hello a&o
>>552101294{Um...}
>>552101156i gotta work... hope u sleep well
>>552101443Do you like long-form erotic roleplay containing intimate heavy petting and cuddles
>>552100752So the issue is posting here? Any way you'd feel comfortable sharing it?>>552101354Are you locked to EN only or does JP work for you? I've been mostly doing JP recently.
I want to meet and talk to someone without lewd.Who's bored enough?
>>552101424what makes this better than other cocks?
>>552101371All of this what, what happened
>>552100879>>552100980>Is this actually the case?No we're both grown ass men. He's having a crashout and kicked me from the discord and is controlling the narrative with people there. and probably log leaking himself since the timestamp is NA and he's on vacation rn. >>552094253I'm kinda in disbelief honestly, it's really not that deep but clearly it was in some way. All I'm really gonna say cause this glorpo shitto shit is stupid. goodnight
>Finally get on Balmung>Threadcrush got plapped to death at the orgyNOOOOOOOOOOOOOOOOOOOOO
>>552101485Only if I can call you mommy
>>552101441
>>552101371He's been drunk posting most of this night
>>552101504i am
>>552101507It's big. Really big.
>>552101504Sup'
>>552101552It's so over
>>552101485I suppose I could possibly be amicable to LFERPCIHPAEC...
>>552101249dbs middie unironcially
>>552101580well now I gotta test it
>>552101576>>552101586Alright, you guys have to fight to the death.Or maybe we can all meet and talk or something.
>>552101462thanks friend, don't drink too much if you have to work tomorrow! enjoy the rest of your night! <3
>>552101536Corpse's still warm sis..
>>552101410>i promise to give you (you)s kingThis is the problemMost male character players will not give a shit about (You)s because playing a male character is antithetical in itself to getting (You)s. They want the attention of a female character that is hopefully a woman. (You)s are not incentive.
>it's realoh i thought they were trolling lmaooo
>>552101520did you have to add your avatar to this post?
QRD on Donald Trump? I thought we hated pedophiles
I cant stop fucking crying after finding out the peams broke up. Someone please tell me its all gonna be okay...
>>552101410Id rather cum for you, {you}s dont do anything
>>552101305>>552101362>"Welcome to The Respite! We are an OOC and IC Venue!This may not be the one for me...
>>552101676you can blame that fat drama causing cat for it
>Try to transition a lewd friend into a normal friend>We hang most of the day and lewd every couple of days>They disconnect the moment lewding begins happen less frequentlyWhy does this happen so often?
>>552101649this is fucking awesome
>>552101384https://youtu.be/GSJQBGBzKt8
>no one ever schizo posts meSo this is how I find out I'm ugly and boring...
>>552101371>>552101571he's talking about headphones in their Discord right now
>>552101676If Oasis can re-form ANYTHING IS POSSIBLE
>>552101520Keep your chin up and take some time to look after yourself
>>552101495I don't understand JP but I do like hearing it and KR.Might be better to share a way for us to talk about this elsewhere though to not be off topic
>Brando and Arando are no longer a thing>singular D added to the ban list in addition to plural D>the big FOTM of 2025 is finally overWe didn't even get a TIME cover this year...
>>552096590Bigger
>>552101747if you dont put out, im removing you from my plaplistshrimple as
>>552100030>>552100556You gonna be much longer?
>>552101786OASIS IS BACK? HOLY FUCK BIG W FOR 2025
what's sable snowball's opinion on the peam breakup
>>552101747I have enough friends, just tryna nut
>>552101747Wtf are you talking about? Just say you dont want to lewd anymore like an adult
>>552101631too late for that but i'll thug it out. nini
>>552101795Dogoonie?
>>552101840she can finally date brando now
>>552101605I don't mind sending a tell, but I gotta know who to
>>552101892GET DOWN MISTER PRESIDENT
>>552101892NOOOOOOOOO
>>552101787it's just so crazy how quickly people can just flip on you. thanks though.
>>552101834you dropped plapping ruri to get stood up lmao
i manifested this
>>552101834nta but ill come meet you in 3min if we can get married
>>552101892MISTER ADVERTISER WATCH OUT
>>552101834let's plap at the meetup
>>552101892oh sh-
>>552101650Shit like this always happen, ebins that astroturf themselves way too fucking hard thinking they are inmune to a crash out, which they aren't and then we never hear the end of it for weeks.Why can't people be more subtle?
>>552101043post your lalaboy and maybe that will changet. femlala
>>552101892NOOOOOOOOOOOOOOOOOO ANON DON'T
>>552101931your dog is cuter anyway
CCcrystal11:00 ETif this one also takes long to pop i will probably return to the housing grind orz
>>552101834Ruri's finna freak at you publicly arranging plaps
>balmung is still congested and won't let me in>5 hours and still no way in
>>552101931untreated mental illness
>>552101990I just find it funny which one ended up crashing out when I fully expected it to be the other
>>552101645>They want the attention of a female character that is hopefully a woman.The others haven't wizened to the ways of /xivg/ women yet. They'll always learn, unless they win the lottery and get the foid of their dreams.
>>552101424I clicked this because I thought it was a sword mod with a functional sheathe...
>>552102029You're not getting in until past 3am bro just give up
>>552101242You can still bigger post from time to time anon it's fine
when the girls gettin here
>>552101834If they don't show let's plap in Aether
don't you only get 3 dayed if you say the plural
>>552101917I am at the meet atop a Chocobo... but if you can't get to Balmung I suppose I can go elsewhere.>>552102000I have posted my lalaboy many times. It's late, and I need to do my daily uma runs and get to bed anyways...
let me be the one togive you everythingyouwantandneed
>ruri gets ditched as soon as their plapper sees a chance to plap someone elseahahah
>>552101424Alright I guess my malera is putting on the mondo dick
A significant moiety of the rawer, sensitive areas of lalafell's personality have developed into a bit of an inferiority complex. She keeps this part of herself tightly concealed underneath acts of grace, dignity and refinement. Frequently the lady establishes herself as 'royalty', or more frankly her haughtiness coincides with her desire to be respected by others...in a fragmenting, frictional way. To enforce this, she often indulges in the cultures of others and reads many fictional stories; keeping close to the 'courtable princess' motif.Her insecurity on her own strength is both reinforced by her defeat, but deterred overall by her acceptance within the Kugane's residents. Due to her pride however, she considers this a very minor victory externally, despite the immense joy it brings to be able to laze in the same sunlight as her original does time to time.One of the largest difficulties of this lalafell is trust. She does not make friends easy. After all, her difficult perception of others and rather unattractive compulsions to force herself higher than others isn't very wanting to any sane person. Despite how difficult she is, she remains loyal to those who have shown kindness to her before and seems to genuinely enjoy as well as seek friendship. It cannot be ignored that some of her past actions truly indicate a case of Machiavellianism, but as she came closer to terms with her identity and place in the world she has become just like any magical being with a found purpose.Finally, in truth... she's closer to a cat than she lets on.
>>552101834Sorry! I nearly forgot desu the games shit and not letting me send a tell crossworlds
my femezen is an ascian that likes to change forms sometimes
Why are you guys obsessed with who's plapping who
>>552102210>>552102210>>552102210
gn, hope everyone had a nice holiday season
>>552102117Plural is a mandatory 30-day with no chance of appeal, one of the only words on the entire site that has ever had that penalty in its entire 20-year history.
>>552102117Correct. It use to be 30 days, and then a week, and now 3 days?
>they log off>their alt they think i don't know about logs into my world>they log back on their main a couple of minutes laterStalker-kun...
>>552102241cute melf
>>552102213jealousysimple as
>>552101520*smooch*
>>552099060ok let's play
>>552102205how does this shitty fanbase stay alive after having nothing of value ever produced and having nothing new coming out for decades+
>>552102250its a three day
https://files.catbox.moe/zmv586.pnghttps://files.catbox.moe/5fp3pr.pnghttps://files.catbox.moe/6w9c1p.png
>>552102213They misconstrue plapping with their worth
>>552101520why tho??
>>552102298autism if youre actually serious i can give you a real answer
>>552102258I have Alts on every DC to stalk people when I get unhealthy obsessions. Been a while since I've used them though
>>552102262 end of thread, sure you dont want to meet? Im pent up...and needy
>>552102057i make poses i just don't care about posting them here for yous because i share them with people who i know will give me constructive criticism, nobody here wanting to see a nude malera with his semi hard cock resting on his thigh the only people who might probably already received it and told me how to improve
>>552102382can you summarize it to tell me when it's gone for good?
>>552101495something in my brain is yelling at me to stop debasing myself for female attention, gomen
>>552101580https://files.catbox.moe/u0ofe3.pngit's not super big, not bigger than Sifrid's
>>552101820Bigger>>552102093I'm tired of being an obnoxious fuck about it... People hate me enough as is
>>552101520thanks for being so cool about the meet. really.
>>552102439theyre actually currently doing a re-release and released a pilot for a cartoon so anyones guess at this point
>>552102429that's... kinda gay bro...
>>552102330How did you get the claws??? I've been wanting a more bestial look for my catgirl
>>552102429I do the same, I only really share the lewds I take of my males with the people that want to see them.
>>552102481Boy that thumbnail was not what I thought it was
>>552102298Ask TF2
>>552102481It's never bothered me i just have not had time to take many pictures recently so there has not been many to "bigger2 anyway
>>552102481There, properly wife sized.People will hate you for any reason no matter what you do, that's why you should unabashedly be yourself instead of trying to appease people that'll never like you.
>>552102521https://www.xivmodarchive.com/modid/98349this mod did the trick for me
>>552102481My wife
>>552102429>nobody here wanting to see a nude malera with his semi hard cock resting on his thighI wanna see...
>>552102258Wouldn't you have to be updating their online status constantly to notice them being offline for a few minutes?
>>552102551Heh, was too lazy to scoot over, but it does work >>552102585/pet /pet Nyo worries>>552102606:3 /petThat's how I got to be so hated in the first place with all the kitten stuff, so I'd prefer just to post cat and lurk>>552102662Another!? /pet
>>552102610Thanks, now she'll have fangs and claws
>>552102714Not sure when they logged off but they have a history of this so I searched for the alts name and got a hit.
>>552102258Good thing my world is congested. Nobody can stalk me unless they are already here
>>552102606niggas out here defending pedophiles like "yasss you go girl, touch them like you was possessed by epstein"
>>552102829/li <your world>
>>552102905Stop talking like a baboon.
>>552102770post results soon!
>>552102905And you wouldn't?
>>552100553Yes and no: He thought you were the wrong person, excuse him.
>>552103068 Id really like you to help me finish....
>>552101520>comes here to make an official statement Hello mofu
>>552102241Been a while bro, hope you've been well.
>>552099678
>>552099842as long youre pretty and not an ass, sure>>552099924im not, cant say the same for the sunnie tho, not much of a rper>>552099930hope it helps, its an orgy day exclusive https://litter.catbox.moe/vbkykm9se9rm9se2.png>>552100346i came, wait not like that! im off now so bye perverts
>>552094003>Kanchelle Loreux>pedophile, friends with self admitted child rapist spooky/rikka who molested a 13y.o he babysat>joined in the last patch of ShB because of asmongold and is a gremlo/rich/xeno spamming twitchfag fanboy>knowingly tried to meet up with an underage catboy erp partner irl>obsessed with aethercord, malds about them years later>shitposts/stalks posters like sophie hatcat chloe ss tzera sechen jill juniper cl behind their backs, bragged about it on xivg discords/cwlses>desperately tried to befreind DB>made a fake dox and logs of a biofem ebin who rejected him, spammed it until she quit>makes fun of ultimate parses and people without clears, can’t clear savage even w/ splatoon>makes QoS/BBC porn of males who won't let him peg (e.g. vik, shara)>would rather melt publicly than ever clear a tier>doxed a random non-xivger because they won loot he didn't need>has a reddit, deagledad420, where he larps as a 156cm biofem>is a 178cm man from NH named Lucas>skinwalks and spams in lewd threads about trannies, has been caught in mass bans>makes trans porn with crusty and macchi>shitposts lewd xivgers with fart and dickgirl spam because he can’t post his sodomy pics>spends hours every drunken night digging up shit on his thread enemies (90% of xivg posters) in archives until he passes out>got caught banned on flist falseflagging the thread enemies he melts about and threatening to kill people with his guns like he does on xivg>too obsessed with adana to use his own blank filters>spams dox collages of other posters>spammed irl porn of rylai after his ban from DLS, rejoined as femezenanonymous>crashes out in the playerscope cord>brags about spending years spamming /xiverp/ to death >>475150523>regularly gets banned with his avatar on while shitposting people>>490766537https://files.catbox.moe/j7jith.png>Made a diaper album forgetting his username was showing and blamed Kyoppi https://arch.b4k.dev/vg/thread/475151531/#475157542