Previous Thread: >>557554049>Guides, Resources and useful links:https://rentry.org/bagguides>/bag/Circles/Clubs/Friends:https://rentry.org/holdingthebag>4koma, Manga, Side Content, PVs & Shortshttps://rentry.org/bacontent>>(JP) – JST>Banners:>2/12 After Maint – 2/25 10:59Yuzu (Battle)Eimi (Battle)>News:Patch notes: https://bluearchive.jp/news/newsJump/634>Events:Decagrammaton Showdown – 2/13 11:00 – 2/18 10:59Valentine's Day Promise – 2/18 11:00 – 3/4 10:59>Content:Total Assault: Binah (Field) – 2/18 11:00 – 2/25 3:59Limit Break Assault: The Fury of Set (Field – w/Special Armor) – 2/13 11:00 – 3/18 3:592x Normal – 2/12 4:00 – 2/18 3:592x Bounty – 2/18 4:00 – 2/25 3:592x Account EXP – 2/21 4:00 – 2/24 3:592x Commissions – 2/25 4:00 – 3/4 3:592x Account EXP – 2/28 4:00 – 3/1 3:59>>(GLOBAL) – UTC>Banners:>2/10 After Maint – 2/24 1:59MiyoFuyuSatsuki>News:Patch notes: https://forum.nexon.com/bluearchive-en/board_view?thread=3367918>Events:To Whom Art Belongs: The Fate of Forgeries and Aesthetics – 2/10 After Maint – 3/3 1:59Search for the Hidden Seeds!: https://bluearchive.nexon.com/events/2026/02/wildhunt – 2/10 After Maint – 3/2 18:59The Arius District's Emergency Class Mission – 2/3 2:00 – 3/10 1:59My Office: https://bluearchive.nexon.com/user/myoffice>Content:Total Assault: Geburah (Field) – 2/17 2:00 – 2/23 18:59Limit Break Assault: The Fury of Set (Field – w/Special Armor) – 2/11 2:00 – 3/9 18:592x Bounty/Scrimmage – 2/9 19:00 – 2/16 18:592x Normal – 2/16 19:00 – 2/23 18:592x Account EXP – 2/20 19:00 – 2/22 18:592x Lesson/Hard – 2/23 19:00 – 3/2 18:592x Account EXP – 2/27 19:00 – 3/1 18:59
good job ritsu
I just remembered it's Jeb! tomorrow fuck
>>557578352Should I roll for Ritsu?
deca status?
www.youtube.com/watch?v=3ZlvSiuI8So&Why are nips so angry about this leak?
I was promised seia bread
Decagrammaflop
I called off all my appointments for tomorrow and will stay awake until the new story is fully outThis is legit the most anxious I've been regarding the game's story, not even Vol F got me this rattled
>>557578352She's cute.
Having a gorilla wife is tough.
https://x.com/gsc_goodsmile/status/2023233668072747070Arius Chocopunis have been restocked
>>557578652>staying awake for a story you have to translate with softwareanon...
>>557578701I fucking TANKED that
>>557578725Why did these things become the new fumos?
>>557578513>why are people so angry at being spoiled on the ending?
>>557578509@3% health
>>557578513>Why are nips so angry about being spoiledWho knows if we don't end up saving the deca brats I'm going to go rub my nut sack on Nexon's doors.
You're thinking of plushie sex
Please give thanks to pic related for saving blue archive
>>557578878The never kill yourself trend became, well, a trend
>>557578834I can read nip
>>557578863How do you know he isn't multilingual?
>>557578929They should've ended this 2 weeks ago, the gimmick's getting boring
KOYUKI DID NOTHING WRONG
It may not seem like it, but this is a Hasumi general.
>>557578513Kind of a retarded question isn't it? Even the Koreans heavily mark spoilers from what I've seen, all Asian countries are smart enough to make sure to not ruin other people's experience reading a story. Only American's tend to not understand at all, and think that spoilers are good. Japanese people are a very anti spoiler culture because its a high trust society, they try to protect others first time reading the story without trying to ruin it. Its the lesser cultures that don't really understand the "high trust" aspect.
>>557578942We don't save them, we've known this already
>>557578513The Japanese fucking hate spoilers, anonLike murder you on the street levels of hate
>>557578954That Koyuki looks off...
>3.7%>90 minutes until I get enough tickets for another runI'll have to pyro refresh won't I
Happy Chinese New Year /bag/Jerk off to horse porn today for extra feng shui this year
Don't forget to pat your students, bag
>>557578863>tfw Plana and Arona have to be on defense duty whenever Sensei is on dates with Mika
>>557579050that's me inside the belly
>>557578513Wanting spoilers is such a zoomer thing, all they want is the instant gratification of knowing how things pan out for the DOPAMINE without the experience of going through it themselves.
>>557579260It's tomorrow sensei
>why do people hate the guy who cried "Snape kills Dumbledore" it's just a prank bro
>>557578352who
Nice gift
>>557579339Something something timezone
>>557579361bella fucks the vampire and gives her baby to the werewolf as a child-bride.
>>557579289But her favorite gift is the gamegirl, not the titty bear
>>557579330Meanwhile millennial faggots cry and shit themselves over even the tiniest reveals because the only works of fiction they consume rely on cheap shock value twists and don't have much to offer outside of them
>>557578513because leaks are for browns
>>5575793614chan has changed slightly, because yes we do that and yes we laugh about it, but we knew it was a jackass thing to do back then, which is why it was funny. These days zoomers don't even understand it being wrong, they can't comprehend it at all. They'll say spoilers as much as possible and act confused why its an issue.
do your part
>>557578863Man Mika was so cute in the shorts. I miss them
>>557579531Zoomer detected.
>Iroha>Ibuki>ChiakiWhich two get alts and which one is the rerun bait? Or do you think one of them will be a welfare student for the event?
>>557579189>American'sThe channel appears to be Thai, or at least that's what I'm guessing from all the squiggles.Hell I'm pretty sure the big Volume F fight at the end of the false sanctum raids was also leaked by a Vietnamese account or at least by someone from that part of the world.
>>557579615i don't wanna put her down
Stop wasting imeji! You don't want a repeat of last thread! Only post good imeji!
>>557579603if you applaud retarded behavior ironically, retards will start to do it unironically.
I see birdI YEET
>>557579615DIE FASTER
>>557579774I'd say Chinese also don't seem to care too much about spoilers, I think its a culture thing usually.
>momoi is more relevant than your waifuhow does it feel to lose to a gamer slob
1% lets go
>boo hoo the nigger faggots playing on the JP server are upset over spoilers like the Deca cunnies dying while talking about content on the Global general that will only see those in 4 monthsHypocrite much?
>>557579616>It's already been a year since the shortsTime flies.
>>557580062I'm afraid you're not the only one who lost to a gamer slob.
>>557578863Why does this look so horrible?
>>557580035I heard rumors that HG Endfield is going to be the first trial for enforcing bans against leaks or something
Babuchive
>>557579773Probably Iroha and Ibuki with welfare Chiaki
>>557580246Impressive Now say that again without crying this time
>>557580389I don't get it
>look mom I posted it again!!
Wildhunt summer, y/n?
>>557580302Because it's fake
look, smegI posted it again
>>557580332How can they tell which ones the leakers?
>>557580302Because they only released the swimsuit shorts on Twitter where the video compression is through the roof, and on top of that it was compressed again to fit within the 4chan file limit.
>this makes discord troons kill themselves from rageIbuki is powerful...
>>557580459the game
>>557580454Weren't you the ones that didn't want to share a thread with GlobalCHADS and ran away to your shithole in /vmg/? Why should I have any mercy when it comes to spoilers?
>>557580454How do you know if that person is crying?
>>557579189Holy rent free
>224 days and 6 hours ago
https://x.com/chia_hono/status/2023231725124604351?s=20its that place from the hit game Blue Archive
>>557580605good smegu
>>557580605
>>557580302it has less than a quarter of the bit rate a typical full hd video hasit should be shrunken to 720p if not 540p>>557580670retardhttps://www.youtube.com/watch?v=rYpJGj7E7NI
>>557581039Come to think of it why don't we see random ass students in background shots? There could be a few variations on each background shot to make it seem more lively depending on the context.
>>557581039I recognized it because I saw an IRL streamer walk through there during New Years
>>557579450No anon even with the timezone (china follows UTC+8) it won't be the new year for another 11 or so hourrwwwowoeoeoeodosssksaaapwpwpwppqpqpqpqkdkfmmm
>>557581630Anon?
>get punched>forgive>get shot>forgive>i'm a little distrustful due to my circumstances>WTF I HATE MIYAKO!
>>557581630>hourrwwwowoeoeoeodosssksaaapwpwpwppqpqpqpqkdkfmmm
>>557581630rip niggaI hope they have cute students wherever you end up
>>557581630Sensei died of stroke while typing this.Time of death: 5:36 A.M
>>557581826I'm glad this artist quit BA.
who are you quoting?
>Chiaki Iroha Ibuki>Makoto and Satsuki havent shown up in the shorts yetAny guesses what alts they will get if they get something within the next month?
WILL I DEFEAT INSANE OR WILL INSANE DEFEAT ME
>>557581981Okay, Hinafag
Remember twitch drops? can't believe I went out of a way to make a twitch account for 200 pyro and they are never doing it again
>>557582123Where's your Mash she's literally free
>>557582123> Showing Satsuki instead of his healer and repositioner.
you
>>557582240She does chip damage to Geb. It felt like a waste of coins
Aaahhh 10-ticket in 4 days
>>557582476>tfw sweating bullets
>>5575824761-2 more hours I guess
>>557582476Kill it faster
>>557582476Kill it slower. I need more mats.
Why won't she leave the meta?
>>557582684You can easily get by without her if you aren't aiming for le 1337 epic rank 1 speedruns.
>>557582684Who else is gonna keep Mika fed?
>>557580605Where are her gigantic dinner plate areolae?
>>557582804>swimsuit UiGood times, man.
>named saori>is sorry>named hare>has hair>named misaki>gives me sucky>named ako>is a cow
chat am I gonna make it ?
>>557582967>named momoi>is my mom...oi
>>557583002hmmmm nyo
>>557582476i have 8 tickets leftshould i spend my pyros to buy more tickets
>>557582880My stinky wife is due for a new alt.
>>557583002time to say your last delusional words, deca
>>557582804>Mika gets roll cakes stuffed in her face by Nagi all day>sensei asks her to come help with something>gets roasted potatoes stuffed in her face by Hare all dayMy chubby princess
Akane Love!I must continue the world of dreams
>>557583087Do you have anything left in the store to get? It's only like 5 pyro a ticket, buying 2 won't hurt.
>>557583087Probably not. unless you're just short of some reward. I wouldn't.this is a "how do I know I've had enough fun?" type question.
>6 hours agoRumao.
>>557583213Fuck off.
>>557583164forgive?
>>557583263Nah.
sex trio
>>557583213/sora/ is 1 day old what are you yappin about
If sensei doesn't forgive Deca, that proves he is nothing but a mere hipocrite.
>>557583213what's lil gup talkin' 'bout?
>>557583542I didn't forgive your fatass either, Kaiserkek
>>557583384
>>557582684She deserves it
>>557583301@arona Quote Theoden's speech to Saruman to this nigga for me
Release her
Why are there a lot of nozomi ryona art?
>>557583760Did they torture her?
>>557583178Mika has a hard life...
>what will happen to Deca?>what will Malkuth say and do? What will the conclusion to her character arc be?>will there be ANYTHING to give hope that the gakis will return?>what will Sensei do after this? He's very quickly and obviously reaching his limits. His own actions need to be addressed. >what will happen to the prophets? What will the justification be for them to keep appearing as raids?Plus a bunch of other stuff. There's so much that this last update has to get right, I'm nervous. Please stick the landing, the execution is the only thing that's getting any real complaints so far, if you fix that then there will likely be no issues.
>>557584037> RaidUhhhh who gives a fuck? Why is Wakamo still a hoverboat, why is Hiero still a thing, and why is Yesod?It's a gameplay thing, you don't need to be consistent with it.
>>557582476If it has a halo she's a cute girl, thats how things work in this gameSooner or later this girl and all their prophets will be throwing valentine's chocos at (you)
>>557584037Anon, I...
>>557584120>Why is Wakamo still a hoverboatshe stole a new one>why is Hiero still a thingMaestro is still experimenting>Yesodthis is literally 100% explained (they're all effectively immortal)
>>557583760>koyuki bunny suit>koyuki pajamanope, Koyuki (Rehabilitated) soon
>>557584037feels like there would be a shitstorm of Deca survives this.also imagine a recurring Malkuth after this event where it's basically a friendly sparing match as a justification for it?
>>557584230I'm genuinely baffled Koyuki's bunny alt isn't playable.
>Vol EX ends in a few minutesAre you ready to say goodbye /bag/?
>>557584294The shiroko terror raid wasn't repurposed as recurring content and is still stuck in Volume F. I doubt Malkuth will be recurring content either
>>557584314I've heard claims it was blocked for some reason
>>557583715gotchu boo>>557583301"I will forgive you," said Sensei at last thickly and with an effort. Several of the Clankers cried out gladly. Sensei held up his hand. "Yes, I will forgive you," he said now in a clear voice, "I will forgive you, when you and all your ambitions have perished. You are a liar, Decagrammaton, and a corrupter a men's hearts. You hold out your hand it to me, and I perceive only a finger of the claw of Big Coffee. Cruel and cold! Even if your war on me was just--as it was not, for were you ten times as wise you would have no right to rule me and mine for your own profit as you desired--even so, what will you say of the children that lie dead there? When you hang from a gibbet at your window for the sport of your own drones, I will forgive you. So much for the house of Sensei. A lesser son of great sires am I, but I do not need to lick your fingers. Turn elsewhither. But I fear your voice has lost its charm.”
>>557584393it only ends when the decagirls become rollable
The nips are beating up vending machine like it's LA in 1992
>>557584437The deca fight for sure stays in vol EX, but I could see malkuth showing up maybe as FRR since her mechanics are well suited for it and they don't justify anything they put in there
>you will never have a studentwife who will support your hobbies
>>557578476Only if you really like her
>>557584037The offshoots of the other prophets (Binah and Chesed) still exist in Kivotos. Based on how she is written she will serve a function to be a some sort of a mediator to Millennium and the hostile environment of the Abandoned District. She also answers the question of how Chroma/Color is formed because her existence contradicts Nameless Priests' argument of "no accidents" in how a Terror is formed given how she is an inhuman being who became human.Given the symbolism of the epilogue, Decacunnies are gone forever and if they return they will not be the same. These are all speculations of course but I'm pretty sure some of the things I said are consistent since the devs are trying to deviate against Isakusan's insistence of maintaining the ruination + fragmented schools status quo
>>557584294>Deca survives thisThe ED where Malkuth orders coffee from a vending machine implies it won't
Prepare your apology nowYou have one hour and 30 minutes to do so
>>557584037>what will happen to Deca?ded>what will Malkuth say and do? What will the conclusion to her character arc be?she WILL become my student and find her purpose eventually>will there be ANYTHING to give hope that the gakis will return?yes, the fact that they don't possess the mystics means we can use reverse ENGINEERING >what will Sensei do after this? He's very quickly and obviously reaching his limits. His own actions need to be addressed.grind harder at work so he can upgrade his adult card to PLATINUM for a higher limit>what will happen to the prophets? What will the justification be for them to keep appearing as raids?binah will remain maki's slave
I somehow have a feeling they're not gonna explain the voices that aris and kei heard, and specifically the one that kei refused to explain to aris when she asked about it. At least in this volume
I'm more interested in the next content than in the ending of EX
>>557584869Probably because they don't even know the answer to that question themselves lol
>>557584869they are probably nameless priests calling them back to their side
>>557584775>Decacunnies are gone forever and if they return they will not be the sameI STILL refuse to believe this. >the devs are trying to deviate against Isakusan's insistence of maintaining the ruination + fragmented schools status quoCould you elaborate?
>
>>557584919You will enjoy your PJ rerun and like it.
>>557584919Same. Im ready for it to be over. We've been holding in the shit that is Volume EX for 15 months now and it's high time they finished it and let us move on
>>557584130Blimp-chan died though
>>557584637>I will accept all criticism, but I would never serve cold coffee to you, Sensei... That'll be 150 yen please.
>>557585075I'm still missing a few Tokis...
shut the fuck up i dont care
NO YOU SHUT THE FUCK UP
>>557585212>paying 2250k per Toki eleph
Blue Archive is at least half based on Index. Which is why its the big collab they really wanted early on.
what does "taoo" even mean
>>557585020It's just the usual Isakusan boogymanning, pretending that all the status quo stuff came solely from him
>>557584775>>557585020I can see a plot where the Decalolis are return to life, but they do not have any memories and this time around they do not have a programmed love for their older sister or recognize her face because what brought them back didn't care or realized about their original selves, bonus points if they don't even realize their origin or whatever brought them back gave them mystics/halos so they assume they are students and always been students and we don't realize they are back until we see one of them in the crowds and be confused to why we are stalking them.
If Im so very good looking, why am I sleeping alone?
HappyendingGODS, be ready for the WIN
I feel like if a Student REALLY wanted to kill Sensei, then they would easily be able to get past the Arona Barrier.
>>557585431This is BLACK archive, be prepared for maximum edginess and suffering
The Deca cunny dying is just an excuse to go deeper
Don't forget. You can't save everyone.
>>557585427Shut the fuck up Morrissey
>>557584448Maybe the gooks are afraid of playboy going after them, as ridiculous as that sounds
>>557583760>Koyuki (lobotomized)
>>557585406Gehenna childs...
>>557585524If Sensei was actually in peril he could just use his credit card and there's nothing a student could do against it.
I'm tempted.
>>557585020Arius was saved and becoming a proper school districtTrinity and Gehenna diplomacy becoming betterAbandoned District might be cleaned up in the futureAbydos slowly recovering/bag/ discussed this a while back but this goes in line with how every major schools will no longer be at odds with each other because devs are preparing for some sort of an antichrist figure to go against sensei where the teased GSC student being the false prophet/dragon. It tracks given that Kaya is the Judas character and Beatrice is in the Divine Comedy, which means Black Suit could possibly Virgil and Kivotos version of Inferno will be explored. My guess is Gehenna will be the catalyst to this event.
>>557585587
>>557585123Would you drink it? It's just coffee, 100% sanitary.pissfags need not reply
>>557583760We'll get her back after a long correction and she'll be the most docile girl yet
Dying is not enough, Deca must be ejected into the City from Limbus company and the head be allowed to decide it's punishment
My Kanoe sweep...
>>557585761Bro Beatrice is from Umineko
Not long left to go now.
Me when I see despairfags>What you wanted was to be a hopefag>You compromised and became a despairfag
>>557585761>Arius was savedI mean we still haven't seen the end result of what that actually looks like>Trinity and Gehenna diplomacy becoming betterWhere? Lol>Might bePadding>Abydos slowly recoveringHow so? Where?The only reversal we have kind of had on the "le status quo" is Arius but it's kind of half baked lip service for now. We still need another volume or two to explore that. And there's so much shit in Volume 3 alone that is completely unaddressed, let alone the other volumes.
I don't want to go to work tomorrow
>>557585901>right afterMiyo!!!
>>557585967>To hold out hope is hard, it requires believing in something. But to be a doomer you don't have to believe in anything.>A doomers role is simple, all you have to do is claim things will get worse>Its perfect for someone with no confidence like you
If you think about it, the cunnies died for nothing and Deca could have simply transferred Malkuth's, intact mind you, consciousness into the spare body and everyone would have been happy, should Deca really be blamed for those deaths?
>>557585761>Christian and Jewish myth ending>Egyptian will be next (Abydos and Nephthys)>Odyssey being left out means the penultimate end will be Greek themed (the exploration of the Sublime)Would be fucking crazy if true
>last deca run only gave useless orange/purple bluraysFUCK
I'm in care of my precious students, so I will give them all the happy ending they deserveI will enlighten Deca by the end of the day and save her as well
>>557585761the fake pres could represent the golden calf that angered god and Moses, the antichrist, or she could actually be the Tyrant Emperor plot point (though that one doesn't make sense now that I think about it)
ANOTHE FREE TENNERGLORY TO JOHN NEXON
>>557586185To be fair they didn't do that
>>557586194Sensei has always had a basic ruleKids = save themAdults = No, neverNotice how he doesn't ever try to save gematria, beatrice, kaiser executive, or any of the other KaiserfagsBecause they're adults, sensei only guides childrens.
I'm just sayin'
>>557586435Can Deca be considered anymore of an adult than Kei who has lived for probably who knows how many millennia?
What if every student suddenly
>>557586202>the fake pres could represent the golden calf that angered god and MosesThis is referenced in game btwThe 'This is you man that led you up out of heaven' thingWhat was that written on?
>>557586435>>557586194implying that the plot twist won't be that the fact that deca woke up right before the game began so it technically was recently born and thus a child that doesn't know any better.
I shoulda never visited this thread
>>557586679The mystery box
>>557586679fun fact Moses actually broke the 10 commandments upon seeing the cafe, and had to go back up so God can make new commandments. the 10 commandments are basically what the ark of the covenant carries.
We lament the death of the Deca lolis whose existence is inexplicable but not the "older sister" who has to live with the fact that they sacrificed themselves for her.She was literally born 2 days ago.
/bag/ bible study when?
Hello /bag/, been away for a while. I just read somewhere that there'll be a limited archive banner soon. Is this true?
Oh to have a depressed nihilistic teenage wife
>Deca defeated>"I guess people find meaning in suffering">"I must away">Malkuth released, but she's sad because her sisters are dead>"Netzach wont grow anymore and end the world. Leave me be so I can mourn">stays all alone by herself in what seems to be a vain effort to bring them back to life some day
>>557586872which if you think about it technically means she is the younger sister in actuality as the deca lolis are actually older.
>>557585752Wait until the more dynamic pose one comes out.
>>557586850>Moses actually broke the 10 commandments upon seeing the cafemust've been a pretty shitty cafe.
>>557587076I mean calf, was spelling it wrong because they sound the same.
>>557586994Are these leaks or just stuff you made up
>>557587183I know, I'm just pulling your leg.
>>557586850That's not true. I think he might have killed some calf worshippers, but as the leader of the Jews at that point he would have had the legal authority to execute them for heresy.
Alright, I got enough tickets, time for one last fight before the big one...
>>557586976
There's still a surprise left, get ready for some shit to go downt. the voice in my head that describes Yuzu's smell
>>557587021I think she remains the oldest based on the fact that she's real, the Deca cunnies don't really "exist" per say, they say so themselves
>>557586850He broke the original ten commandments that god carved for him by hand. When he went back up the mountain God made Moses carve the second set of ten commandments himself, as a teaching moment.Ark contains the original ten commandments, Aaron's rod, and the pot of mana(plana)
LFG
>>557586435So Sensei's a diddy ahh blud?
>>557587308but anyways it would be interesting because we might end up dealing with an actual false Shittim chest instead of one from another reality.>>557587364I still cannot believe they turn away from God when Moses wasn't even gone for that long.>>557587552ah interesting. also one day they should do an indiana jones references with someone attempting to open the shittim chest's systems to look inside.
>>557587609diediediediediedie
>>557587507>Alice when she's crying and breaking down after Rio bullied her says she's not even a real person, she's just a machine>Anon: omg no you aren't :((>Deca lolis in a moment of self depreciation say they aren't even real, which sensei argues with, and everyone cries for them>Anon: THAT'S RIGHT YOU AREN'T EVEN REAL PEOPLE, YOU HAVE NO HALO, YOU WILL NEVER BE STUDENTS, YOU'RE NOT EVEN ALIVEDamn its almost like their character arc entire match's Alice and Kei's
sensei is a pedo...
>>557587680The whole old testament is about the cycle of Israel turning away from God and then coming back after he punishes them.
trying to strike a chord and it's probably A minoooooooooooooor
Sensei, Rio, Toki, and Eimi are missing according to current dialogue
>>557587609The pace is slow. Burger bros might doze off before they got to know how the story end
>>557587943the people of Israel was like a whoreish wife
Someone give me a JP player streaming the conclusion when Deca is down
Die you vending machine die
>>557587981It actually is about to speed upStuff speeds up the most when people see weakness, they always want to get one more hit in
quickly we must must punish Deca by forcing him to be a vending machine that sells something embarrassing!
Deca is not evil. It merely has a moral framework that differs from your own.But in the end, it had to be this way
>>557585752
>>557588248Like what? Used panties?
>>557587973Those are the people fighting deca. Himari took the twins and Yuzu back to the ship. Everyone else is still fighting.
>>557587801Sorry but it's two different cases anon. The Deca lolis literally spawned out of thin air. Even by the myths they aren't real, they are the light that pours into god's vessel, which is exactly what they did with Malkuth.
>>557588289Give it back.
>>557587973The IQ differential in the room has distorted spacetime
>>557587801>Has halo and is therefore student>Doesn'tMight be a similar arc, but they aint the same, even if I love (at least 2 of) them.
>>557588546What did Ohr ever do to you
/bag/ is such a tsundere towards OhrShe knows she's the favorite
https://x.com/Saki_sukiee/status/2022943180380045419?s=20people are thinkingbut I don't know
>there are Deca sympathizers in this thread
>>557588765She’s that blonde wataten loli
>>557588406This?
we hate ohr, actually
>>557586202>>557586842How are they going to introduce this supposed antichrist figure if Phrenapates already existed anyway? He'd have to be a Superintendent or a HeadmasterAnd how does this false prophet GSC student manage to hide?
>>557588826Ako wouldn't say that
>>557588792I do actually sympathize with Deca. The whole world is a sham. Kivotos is filled with a bunch of gods larping as little girls, and Sensei just enables that bad behavior. The world should end.
I'm fresh outDo your part now
>>557588835Time travel. We see in PV 4.5 a watch that you can see in the wrist of the GSC student.
>>557587308>Calf>legWhy is my brain telling me that you're doing this on purpose
>>557588792There are Issakusan lovers hereAny time the thread is against something, there's at least a few guys that will take the opposite position just to be contrarian.
>>557588765No? It'll always be Ein > Sof > power gap > garbage > Ohr
>>557588835>And how does this false prophet GSC student manage to hide?maybe they were in The mystery box?
>>557588929I am not buying 18 tickets to do one more run
>>557588835We ignore PV4.5 and toss Giga Pina into the forgotten pile, just like idol GSC.Whatever plot point that was, it was probably dumb anyway.
>>557588896-Seething priest
>Meet Potential Man
>>557588978>how do I make this about Isakusan
We love Ohr here
>>557588792No, I've seen the fake God trope more than enough times to know where this goes. I just don't autistically hate Deca
>>557586119My man, the entire planet is demonstrably run by a hedonist cannibal cult.
>meet potassium woman
>>557588792I like him too much as a villain to hate him
>>557588717Was mean to her sister.Probably said something rude in one of their rants.I don't dislike her, she's just nowhere near as endearing as the other two
>>557589184and we weren't invited...
>>557588835At least four or six members of GSC still aren't introduced I don't agree with this antichrist fanfiction though "OOOOHHH BA is going to introduce a new sensei figure who's going to take your students while acting as a false sensei messiah" No I don't believe in any of this fan theory.The academy's are owned by the students, this is already covered in passing. There's no superintendent or headmaster. Abydos district is owned by Hoshino, the schools own their own land.
Meet the spy
>>557589352haine is something like physical activities no?
>>557589129
I thought /bag/ like bratty kidsWhy are shupos getting a pass and Ohr doesn't?
>>557588792Look, say what you will about his goals, but he's salt of the earth working class vending machine. That guy was working out on the streets selling important goods to the masses and building a family, slaving away outside some AI thinktank that does the world no good.You may not agree with him, but gotta respect him, working class bloke like that.
/bag/, is it true there’s a datamine showing Pajama Koyuki’s banner is coming soon?
My precious desert rose.
>>557588792>Spent his life serving coffee>Experience with AI went wrong and he was left behind and abandoned>Literally unable to fulfill its own purpose for who knows how many years>Spent so much time alone it gained a perception of self>Reached the conclusion that he was God because nobody knew he existed>Pursued a plan to make itself known>Got btfo by the one true God>Realized his existence wasn't all that>He didn't even plan to be alive for his plan and was entrusting Malkuth to make his name known>His buddy Kether saved him (the cumplit of everything transpiring right now)>Malkuth and the Deca cunnies were being swayed and he decided to order the ritual>Btfo Arona as he planned just to show off>He wanted Sensei to become his Apostle despite Sensei being of flesh>His plan was to make himself known as a god throughout Kivotos>At the end of the day nobody will remember him again and he will be back to being a lonely existenceTo be Deca is to suffer, he'd have probably been better off dead, if not for Kether...
>>557589479she was mean to Ein and Sof
>Only prophet created by another school was Tiph>It's fucking deadDeca would have behaved herself if she was created by RedWinter instead of Millennium. Millennium's materialistic views made her a monster.
>>557589604She got punched for it. It's fine.
>>557589654Tiph fucking gassed me.
>>557589479I want to throw tomatoes at Shuro.
>>557589129Still zero feats
>>557588945Jer 1:11: The word of the LORD came to me: “What do you see, Jeremiah?” “I see the branch of an almond tree,” I replied.
We are down to 13 digits
>>557589784Her feat is being one of the best dressed students in Kivotos.
>>557589784She broke that artist guy who's name I forget.
>>557589784In Jeremiah 1:11, God asks the prophet, "What do you see?" to which Jeremiah replies, "I see a branch of an almond tree". This vision serves as a sign of God's alertness and commitment to fulfill His word, as the almond tree is known for being the first to blossom in spring, signaling, "I am watching to see that my word is fulfilled". Key aspects of this passage include:Symbolism of the Almond Branch: The almond tree (shaqed in Hebrew) symbolizes waking up or watching, reflecting God's vigilance in bringing His plans to fruition.The Message: The vision signifies that God's word is not slow or dormant but is active and ready to be performed, just as the almond tree blooms early.Context: This is the first of two visions given to Jeremiah to confirm his prophetic calling and the certainty of the messages he is to deliver regarding judgment and restoration. The accompanying verse, Jeremiah 1:12, confirms that God is actively watching over His word to perform it.
Good night
Im impressed at BA for convert many NTR artist into drawing vanilla
>>557589925but it's morning?
How to get Kazusa gf /bag/
>>557589885Rimukoro
>>557589925Night
>>557589654>Only prophet created by another school was TiphWe still don't know who created Binah or why is was fucking around in Abydos for so long.
>>557590049Maki might have been under the sand.You don't know until you've looked.
>>557588784Its possible Kei's momotalks will look different in retrospect after the final chapter comes out
>>557589965This is 100% a dude women dont have legs that thick
>>557589965oh wow i wish the metal on my sink came all the way out to the edge like that, it would make little spills easier to clean up
>>557589654>>Only prophet created by another school was Tiphbwo, yro'ue Hod?
>>557589814>>557589914Huh, so the Divine Comedy link with Beatrice and possibly a Virgil character as a form of Meta narrative might not be a stretch after all. So sensei is not Jesus but rather Dante?BRAVO KOJIMA
>>557590049I think we know
Are Himari and b.Eimi's momos set during the raids or after?
>>557590049might be the same people who built the Utnapishtim, i'm hoping we get to learn more about the ancient faction that opposed the nameless gods
>>557590242All of them except Kei's take place at the Steel Continent. Kei is the one that takes place after I think.
>>557590307Yuzu's also take place after the raid.
>>557590164Hub and Chesed were Millennium's creations.
>>557590443>Chesed>Millennium's creationNUH UH
>>557590443Only Hod, Cheesed were originally part of Nameless Priest
>>5575859485 years of seethe imagine
>>557589965where do i get a cute boyfriend like this?
>>557585948The only way I can see BA nosediving is by releasing unpopular fes students like Poozu and Michiru, and adding aggressive monetization schemes like Genshin's constellations.
>>557589784>stole the heart of senseis everywhere without a single interaction
>>557590443Hod is literally Divi:Sion if what Black Suit said is true
>Geburah: Idol extremist>Chokmah: Dragon Quest RP with Arisu>Tiphareth: Lolicon>Chesed: Afraid of Gorillas>Binah: Maki's fan club founder>HoD: Local cable guy>Kether: War Criminal.>Malkuth: Zoomer, Mahoraga is her favorite
>>557591003You'd never expect Kether, the least harmful and impressive prophet to be the reason Deca is still around
Who is Hina? For the blind, she is vision. For the hungry, she is the chef. For the thirsty, she is water. If Hina thinks, I agree. If Hina speaks, I'm listening. If Hina has a million fans, I am one of them. If Hina has ten fans, I am one of them. If Hina has only one fan, that is me. If Hina has no fans, I no longer exist. If the whole world is against Hina, I am against the whole world. I will love Hina until my very last breath
>>557591003Listen man, sometimes you just appreciate a good show.
>>557590842They released Hanako, the most unpopular out of the 4 retards from the Make-up club, and she sold buckaroos because of powercreep. They can get away with anything.
>>557590682>>557590842By the way, Comiket opens registrations tomorrow
>>557591289It's going to be a Kei sweep guaranteed
>>557591003>Yesod is so hated he doesn't have a meme about him
>>557591168Makes me wonder why Kether, the sephirah representing the heavens and the crown, is the weakest prophetMeanwhile Malkuth the one that represents the material world, the bottom of the pyramid, is the strongest prophetDecagammon completed the cycle in reverse didn't he? Its not entirely clear why. He had the heavens but sought the material world? There's some sort of symbolism there.
>>557591003>>Tiphareth: LoliconWhy?
>>557591336he's a fighting gamer
>1%
>>557591438>Recommended students: Aoba, Hikari, Nozomi, Kisaki
>>557591241Didn't read but I made this post
>>557591428because deca is a demiurge and the demiurge is tied to the physical world, not the spiritual one
>>557591428He wants to be the little girl
>>557591332I just hope BA stays on top again desuReally don't want to deal with all the shitposting we'll get otherwise
>>557591168Excuse me?
>>557591576Vtubers are almost there but it aint the same if it's not a game
>>557591336He's a gamer >>557581405
>>557591332A lifetime of Kei doujins... God, this sexy little robot will continue to make me lose gallons forever
No turning back now.
>people keep replying to the concernpost
Miyako's sexy sculpted body
>>557578476Yeah you shouldFor your Meg
>>557591336you're behind on the memes
Pat you are students
Time for pats.
Useless Decagrammaton faction commentary:>Decagrammaton>The anti-Absolute Being Autonomous Analysis System, Decagrammaton, takes over Malkuth's body and manifests as a god. However, its true identity is an AI that calculates change from vending machines.>"Who are you?">He couldn't answer that question. >Because he was "nobody," hes just a vending machine. That's why he aimed to become an "absolute being." Just like the girl who was born as the "Demon King" who would destroy the world longed to be a "hero." If he had had "friends" who could pursue his dreams with, or "adults" who would tell him, "You can decide for yourself what you want to be," then perhaps his future might have been different.
>>557591875look at him go!
>>557592021forgot the image
>>557592021There was art of Sakurako getting a drink from the vending machine and being confused when it talked, and asking it who it is. Wish I saved it.
FUCK SAKURAKO
I too want to fuck sakurako
>>557592217she rickroll'd me... in fucking 2026...
bing bing time to pat your students
>>557591165>presenting
The end is nigh
>>557592275are you even trying?
>>557592275you're late
>>557592275
Bros, I'm gonna be honest, Vol EX wasn't as cool as the PV made it out to be. I was disappointed they reused stills from the PV instead of expanding upon them. The BRio/BHimari part was especially disappointing. It barely lasted 5 min.
>>557592749based Junky keeping Senseis in line
>>557592895Yeah the lack of original CGs was pretty terrible
>>557592895Because it's much more introspective and even somewhat philosophical, not the action-pumped romp the PV made it out to be (Daath aside)
>>557592895The Rio / Himari part was at least to easy follow. I was much more disappointed by the Malkuth / Aris+Kei segment if we're talking production values considering it's the climactic scene of PV6. They picked really bad stills and the way the action flowed felt confused from start to finish when you read it.
Save her
Lotta the revelations in volume F only happened in like the last node or two, and the epilogue. So doesn't that mean for Volume EX we
>>557592895Honestly there was no way Vol EX was going to work out. From my standpoint, it's pretty ridiculous that this ragtag group of Students managed to take down the entire Decagrammaton army when these were formidable raid foes in general. I'm not really a power level guy per say but Vol F had several different specialists to take down specific raids, I just feel this is a tremendous stretch to accomplish a full conquest of the army in just a single day spam.That said pretty enjoyable still.
>>557593003The problem is is that the philosophical elements aren't even that good. It's just basic bitch free will shit
>>557593142It's not possible. She already passed onto the train station just like Yume.
Malkuth died faster than this at 1 percent. Die alreadyyyyyyyy
>>557593142>Kuma runningRed flag...
>>557593209Watched pot doesn't boil
please last another 40 minutes so I can save 5 pyro on refreshing tickets for my last run
>>557591657vtumors had been lagging quite far behind last I checkalso isn't that entire industry dying? good riddance.
>>557593182I didn't feel too much in disbelief since you have Alice and Kei having nameless god hax powers helping everyone out. But it would've been nice to have a bigger cast within millennium at least. I guess dev resources and time were pretty tight so they just had to stick with the smaller cast
>>557593280I am going to make some tea and watch it boil just to spite you.
Vol G and Vol 7 will save the game.Trust the plan!
>>557593360>>I guess dev resources and time were pretty tight so they just had to stick with the smaller cast>this shitpost AGAINFuck offfffffffffffff
>Taobao is doing a limited run of gigantic MIka plush (60cm)Fuck I'm so tempted
>>557593179You shouldn't be here at this hour.
>>557593456>shitpostThey literally said in the 4th anniversary stream that their resources are quite a bit tighter than they used to be. Why are you upset/in denial over something that was plainly admitted by the developers? Nexon pulled a third of the staff in December of 2023 to work on RX, and then they lost another third with the KV drama. They never got back their full staff numbers.
>>557593456>it's a shitpost because i disagree with itCome on now
Why is the Twitter For You page so retarded. I click ONE JP Vtumor drama post and now my entire feed is full of it. I just want cute art of my Students...
Vol Ghanhaijing
>>557593456It's not a shitpost. They've already mentioned like twice by now in interviews that they had very little time to send in materials to the animation studio to make the PV. And in order to do that, they needed to plan out the script, which meant planning out which characters were gonna make the cut versus which weren't. Within realistic deadlines.
gocern...
>>557593360I don't necessarily dislike it mind you. Vol F clearly had a bigger threat all around, and everyone in this current group has pretty much levelled up considerably, and Decagrammaton to boot proved to be much more of a bigger threat than anything else, that just goes to show how far above god stands over his prophets. That said I liked having a smaller cast of characters that can be focused and developed, my biggest grip with Vol F was exactly the "avengers assemble" feel shit with characters that barely had much of a screen time up to this point, and especially characters that had never interacted before, ended up interacting in a very insignificant way imo.I much prefer what we got with EX overall despite my power grips with it.
>>557593558>They never got back their full staff numbers.They also said multiple times the BA team is larger than ever right now
>>557593607>they had very little time to send in materials to the animation studio to make the PVhonestly one of many reasons why fully animated PVs while cool are also incredibly stupid
The best shitposts like >>557593558 always have at least one grain of truth to them
Gook thread, start
>>557593661>despite my power grips with itwtf is a power grip
I love Hanako
>>557593571You have to treat that page like it's a special needs kid in order for it to give you what you wantOr just follow a bunch of artists you like and just go to the Following tab and be done with all that crap, since it'll only show you posts from artists you follow
>>557593662>larger than ever>events, reruns, and story volumes getting less production values than everYeah, something doesn't add up there.
>>557593571Why does this one look like slop?
Anything that isn't praise is shitposting, deploy Seiaspam to save my fragile mind from the existential dread of the world that isn't all sunshine and rainbows.If even one thing isnt flawless, that means we're EOSing, is how my mind works. Can't let that thought gnaw on me.
>>557593775
>>557593775As in, my grips with the power scaling stuff
>>557593679It's either that or they have to make the powerpoint slide PVs in-house again. Which they don't seem willing to do anymore. That's a lot of pressure on the art team. Decision was made somewhere to just make storyboards and let some other outside studio handle it
>>557593902Nobody has been shitposting you retard, why do you do this to yourself
>>557593902Raped beyond belief
Doesn't the lack of developer resources statement only apply to the content that was in development during the time frame of the Idol event (Which was probably in development when the traitors left) and Summer Hyakkaryoran? They probably should have more resources now.
Hina Feetina
>>557593902I mean, if you insist
>>557593902KWAB
>>557593376>teagrandpa drinks tea?
this is a coffee general
>>557594018i'm hoping things will slightly pick up at least on the art side since we've been seeing new names lately, accounting for time lag. off the top of my head jehyun, blanchat, and raimuri have made new character illustrations, which were names you didn't really see last year.
Why don't they just hire more artists instead of keeping a clique? They keep hiring more people but they aren't artists
>>557594169cute wappi
>>557593835Elaborate please.The latest event had multiple cutscenes and a world raid which we haven't had for a while. What part of the production values are lower than ever?
>>557594018No. It was mentioned in the context of the lack of rerun alts lately. They said they can't spare the manpower on them. It also is obviously extending to story volumes. Both Volume 5C2 and Volume6C1-3 had very sparse production values compared to prior years.
https://arca.live/b/bluearchive/162555642?p=1fascinating
>>557594169
Artists are territorial and cliquish
>>557594254rape
>>557594236>The latest event had multiple cutscenes and a world raid which we haven't had for a whileI am not talking about the latest story event. Obviously they are putting their all into this. I am talking about the stories and regular events of the past year, which have been pretty light in terms of production values. Volume 6 has, what, 3 or 4 unique CG spread out across three chapters?
>>557594218You end up with trash like this
is she dead yet?
Maybe we'll figure out soon why she's in her school uniform.
>>557594240>the context of the lack of rerun alts latelyThat shit was mercy in disguise, look at all the students people had to roll for once the anniversary period started
>>5575943600.5%
>>557594254Jeokgok jibbing bingling
>>557594240You're fucking with me right?>CGs for the Hyakko bathing>They made a whole ass raid boss as a joke>One of the best animated chibi sequences>Live 2D of Nagusa's beautiful crying face as well as Ayame live 2DIn what way was Vol 5 low budget?
>>557594240I feel like the lack of rerun alts was because they were planning to finish Volume EX
>>557594376
>>557594376I agree she should have been naked
Guide Kaede will be skipped on the guide event immortalization and obviously this is a crime against humanity
Kaede?Now that's a name I haven't heard in a long time...
>>557594360Decagrammaton is a girl? I thought that tin can dispenser was male coded
>QCherino was skipped because of Sakura Tange quitting
>>557594578Kaede deserves a better alt than that mx2j slop
>>557594482Now compare that to the amount of CGs and content that Volume 5 Chapter 1 got. It doesn't even compare. Not only did Chapter 1 have significantly more CGs, there's also all the satellite assets that had to be made for what was an entirely new club. And that was during the same year that we got Volume 4 Chapter 2 (also significantly more production values compared to V5C2/V6C1-3), and Volume F (I digress).>but chibi sequenceIt really wasn't that impressive. Nor was it particularly long.
0.4% left.
too many people complained about guide Kaedenot enough people bitched about band ASS alts
>>557594612
We call her Maple around these parts
>>557594652>Hurr amount of CGsNigger I don't CARE. Are you seriously comparing CGs to animated Chibi fights? To Live 2Ds?>It really wasn't that impressiveAlright nigger I get what you're doing now. Fuck off already.
>>557594685sus
>>557594491I cast BALD
SEND ME A LINK TO A JP STREAMER PLAYING THROUGH THE REST OF THE STORYI DON'T WANT TO BE AT THE MERCY OF SUMMARYFAGS
ChatGPT ahh post
I care about CGs. They look pretty
>>557594685ZOOOOOOOOOOOOOOOOS
>>557594692>too many people complained about a crime against humanity>not enough people bitched about a below average alt
>>557594713>Nigger I don't CAREWhy wouldn't you care about a fundamental aspect of Blue Archive's aesthetic? This is a visual novel. CGs are part and parcel of that genre. A short chibi sequence doesn't really outweigh the amount of soulful CGs that we used to get littered across the volumes. With your mindset you would be completely fine with a Volume F stripped of its awesome CGs just because it had LE EPIC CHIBI FIGHT BETWEEN PERORO AND KAITEN
Decagrammaton, your end is but inevitable. Die as the arrogant god you wanted to be.
>>557594556>Kei's body becomes human>her deca clothes were considered part of her robot body and disappear during the transformation>she ends up completely naked in front of meGUH
>>557594881why do I have a feeling this is another jujiutsu kaisen thingshould I just nut up and finally read it?
>>557594856Ari and Natsu are way, way below average though
The job i applied to hasn't called me back in 3 weeks even after asking what's the hold up
>>557594946HR moment
>>557594859>Why wouldn't you care about a fundamental aspect of Blue Archive's aesthetic? This is a visual novel.It's not. It's a gacha game, a videogame to boot. The CGs themselves don't have the level of production of an actually high budget VN either.>With your mindset you would be completely fine with a Volume F stripped of its awesome CGs just because it had LE EPIC CHIBI FIGHT BETWEEN PERORO AND KAITENUnironically? If they had animated chibi fights for all of athe Chroma, I'd take that over the boring ass CGs yes.
>>557594915it has a shitty start but it's really good around the middle.after that if you find it boring it's ok to give up because it will never get better after shibuya.the gag artist arc was the best arc though.
Why do people complain about the guide alts? They look fine to me
vnniggers get out
>>557594652>Volume 4 Chapter 2 (also significantly more production values compared to V5C2no it doesn't V4C2 has 0 live2ds and like a 5 second chibi sequence compared to one that's at least a minute, and it has like what 5 CGs? the fuck are you talking about?
>>557594915It's a genuinely good manga, but the final arc is like half of it and it peaks before it.The memes are genuinely funny though
HIKARI YO
>>557595032Bro. You're in the wrong place.
imagine decagrammaton bweehs and we save him but not the decalolis
>>557594946We'll get back to you
>>557594987>Unironically? If they had animated chibi fights for all of athe Chroma, I'd take that over the boring ass CGs yes.Got it. You are simply low IQ. I guess there's no point in arguing further.
>>557595082Probably the only manga where the MC's mom is the big bad It's like Sensei's mom being Black Suit
0.3%
The Blue Archive OST is becoming more and more VN-like
>>557594946you call them, bozoif they don't give you a specific timeframe, call their asses every day until they do
I showed you mercyAnd this is how you repay me?
>>557595202I honestly have no idea what that even meant.All OSTs arr same.
>>557595248
>>557595132Nigger, I'll say this. I'm okay with CGs for Slice of life scenes, but for action sequences? It's a complete fucking waste. It's not even at the level of FSN, it's just stills that sometimes zoom in on the CGs. It's boring as shit.
>>557594795PLEASE
>>557594946A relative recommended me to his employer.Had an online interview last month, went pretty well and the guy told me he would call me on the 9th of this month to schedule an in person interview as well. Haven't heard back from him since and he's not answering my calls.The job market is fucked beyond belief.
just put the coffee in the cup bro
>>557595132>0 retort for the chapter not being low production value aside from "I didn't personally liked where that production went"NTA but you're the one that got destroyed bro
>>557593771
>>557595336Depends on how well they execute it. Volume 2 Chapter 2 had some genuinely cool sequences. Probably the best in the game IMO, that shit was immaculately storyboarded
>>557594946>asking what's the hold upthat would be why
>>557595248Show me my snickers falling instead, you scamming machine
Deca not dead yet?
>>557595370Is there a recession going on right now, or something?
>>557595370I had to give up an internship that was really important to my future because I couldn't find a part time job in the city to afford rentBlue Archive
>>557595338Nigga just search Blue Archive on youtube then filter by live there’s like 5 nips right now
