Real Darkner Bawn Edition Previous hero: >>575370210 Spoilers ahead, proceed at your own Frisk. -DELTARUNE CHAPTER 1-5>https://store.steampowered.com/app/1671210/DELTARUNE/>https://deltarune.com -The Old Game>https://undertale.com-The Old Game's Demo>https://undertale.com/demo -The New Game's Progress>https://toby.fangamer.com/newsletters/>https://deltarune.com/#news>https://web.archive.org/web/20240815033908/http://www.twitlonger.com/show/n_1sqn3p9 -Merch>https://www.fangamer.com/collections/undertale>https://www.fangamer.com/collections/deltarune -Books>https://pastebin.com/1MRmU0Gk (Undertale Artbook)>https://pastebin.com/hLxHi0a0 (Legends of Localization - Undertale) -Extra Content>https://undertaleqa.tumblr.com>https://undertale.com/alarmclock>https://deltarune.com/sweepstakes/ -Text Dumps & Screenshots>https://pastebin.com/79FxaVBV -Fanart Archives>https://pastebin.com/5777YtCb>https://utg.vidya.pics/ -Recommendbin>https://pastebin.com/fsqd5Sa6 -Writebins>Current: https://docs.google.com/document/d/1ZaYVvltQ_Rmf-ggszf1bwmYDW2NUcfpTYU7JzfyMhVE>Old: https://writebin.surge.sh -Comicbin>https://pastebin.com/UJpBYSEE -Fangamebin>https://archive.is/iSiFg -/vg/ League team>https://implyingrigged.info/wiki//utg/ -Wanna change the font?>https://rentry.org/utg-font -/utg/ Canvases>Current: https://r2.whiteboardfox.com/25956339-3439-5746>Previous: https://r9.whiteboardfox.com/96320859-9140-7661>Current: https://magma.com/d/3B5chWd0Vh>Previous: https://magma.com/d/QiFH9rWyRh -/utg/ OC wiki>https://utg-pippins-ocs.neocities.org -Thread Template (paste the current whiteboard links)>https://pastebin.com/rTN8SxAw
I don't get it, why don't /v/irgins want to post here? It seems fine as far as /vg/enerals go
Even floradinns despise AIBe like floradinn
>>575391598We're too gay.
>>575391598you can never know who's behind an anonymous post so this speculation and questioning is pointless. for all we know it's bored thread regulars shitposting as /v/ermin
sex with tenna
>>575391521Hooman!
personal creations anchor, reply with your latest work!
>>575391598FUCK OFF WE'RE FULL
oppa gangam style>>575390842>>575390941my brethren...
i love my little chudling seth!
giwtwm
I'm Black Sans.
Ralsei is never making it out of the dark world therefore will never marry Susie or Kris
How do we feel about Winnie the Pooh?
ralsei butt
>>575391748here's what imagine my ralsei looks like (+the flower faggot dying horribly)
>>575391853I watched him when I was very young. He seemed like a nice young lad.
>>575391853i guess i’m fucked for death
>>575391330Thank you, Susie is such a real character it's really fun to write about her
Seth... why are you so bunny
ralsei hips and thighs
>>575391836not with that attitude
>>575391853The 100 Acre Wood is a Dark World created by Christopher Robin that is inhabited by his plush toys.
>>575391331Proof that self-inserters are always a plague, no matter in what form they appear.
>>575391975made for petting!
how do you even self insert into a character with a defined personality? do you just ignore the parts of them that don't work for you
>>575391836good thing he can marry me>>575391854truke
https://files.catbox.moe/4gqszy.jpg
>>575391752https://arch.b4k.dev/vg/thread/435379336/#q435408121
>>575392084Seth is the type of person to drool and blush heavily while being pet and given attention but also making whining sounds at the same time
>>575391930Mostlys!
>>575392141this is pedoshit just warning everyone
>>575391748(Reposting because I finished it to late)Name her favorite band
>>575392161LMAO WAS THAT ME??? fucking WILD if so that's a crazy post
i hope we get an official comedy spinoff animation of deltarune
>>575391853Didn't watch much if it as a kid but I stumbled across fanart of Evil Kanga a while back and it made me laugh
I think it would be cute to see Ralsei and Seth in skimpy outfits, rubbing on each other and frothing their cute cocks.
>>575392168i want to pet them until they melt into a puddle in my lap!
>>575392140whote gote
>>575392141Seth's petal pubes!
>>575392342this is badass
>>575392124You ignore the things that don't work and hyperfocus and amplify the things about that character that appeal to you. Every intense self-insertion fantasy eventually becomes an OC-like version of the original character
>>575391853more like winnie the poop
>>575392254Mmmmm bait
https://soundcloud.com/lolzez-829357607/megalavania-harp-but-its-moreThis "megalovania harp" (not actually a harp but it's named that by the community for some reason) motif hidden in Megalovania is going to be used in Chapter 7 Side BIt will retroactively contextualize the random unexplainable hidden melody as part of Sans's past with the weird route
please label your catboxesi don’t want to see aqua pornography
>>575392141Nice
Ralsei's first sunrise...Kralsei Forever.
>>575392124its more about how they react to things, like you can imagine if their life was like their's that you'd act like themits not about being literally youplus for some people it's just not like there's really any character at all that can be your ryan goslingi dont think anyone is capable of writing a character like me, because im extremely boring and miserable, doesnt mean i cant self insert as non boring characters
>>575392326I, too, go into shitposting fugue states
almost posted green's giant bare naked tits here oops
>>575392372he’s struggling.. I gotta help my prince
>>575392475i project onto kris because i also feel like a puppet whose last little shreds of self-made individuality is being stolen from them by forces beyond their control
>>575392667happens to the best of us
>>575391864Holy based
>>575392140You're bound to Kris therefore you can't marry Ralsei
>>575392439Apparently it's because her kid fell off a tree or something? It rocks either way
>>575391864cool
>>575392672yeah same... *watching him from a dark shadowy spot in the room and licking my lips* i'm gonna go help him out... any minute now...
it's a good sensation to be praised for your drawing it feels your heart with joy
>>575392256Some hipster ska shit from the 90s
>>575392624It's called catbox roulette for a reason.
>>575392667One time I accidentally posted Noelle getting creampied before I left my computer for an hourThat was pretty funny
I found Rudy and Asgore's joint twitter account
>>575392369Turning Seth into a drooling mess...
>>575393017This very person posts here
im not that good at drawing but i had to make something for my fellow ralsusie warriors
>>575393181CUTE
>>575393054i need it badly!
>>575393181I love you
>>575393132merry christmas in july 6 sugared susies
>>575393181you did a great job anon
this is going to *kill* you.
>>575393181Aww I'm proud of you anon
Undertale was okay because of the meta shit and genocide route, Delatrune has none of that and is just pure trooncore slop with Toby's obvious NTR fetish corrupting it. Everyone is gay or a lesbian and the analogue to the meta stuff is the "weird route" which amounts to like maybe a hour of content by the end and isn't as fun.
>>575393339really really cool chara
>>575393181This is a good drawing.
>>575393475so this is the power of /v/
https://x.com/zzinddacom/status/2081387542394630196
>>575393258>>575393286>>575393334>>575393370thanks ralsusie GODS!
>>575393475wait till you find out about the secret /ss/ hidden in the code
>>575392771I'm free to move around
>>575393475ahaha! i'm biting the hook! i'm taking the bait! reel me in, anon! gut me and flay me and sear my flesh on a salt block!
>>575393494i know. christ, i know. it's always been one of my favorites of all time. just look at those hands....
the secret garden is a fakeass book there's no way
>>575393606cool
>>575393693>>575393592Sorry the "weird route" isn't anywhere as satisfying and entertaining as the genocide route. I don't give a fuck about Noelle and Kris keeps cucking any attempt to make the game interesting.
>>575393161we're on the same wavelength
>>575393793lemon and garlic and rosemary and thyme! i pair well with a nice white wine!
wife
>>575393565thank you anon!
>>575391726ugh that picture is making me angry.you're really pissing me off. I'm sending my cats after you! they will bite you very VERY hard.
>>575394091go back to twitterstay there
>>575392034this could be us, anon.
>>575394091AIIIE! So scary!!!
>>575393793tbf the genocide route is actually pretty boring save for undyne and sans
https://xcancel.com/Nediaxyz/status/2079700042592489531
>>575394329you posted this last thread
...I posted that without realizing Yellow's Yellow Junior was out
>>575394221idk I liked it the most you skip all the boring puzzles and time-wasting flavour text and dumb interactions and you just feel those levels going up and up and upyou still have plenty of fight to fight they're never too hard but filling up the bars feels nicethen you're rewarded with two super hard fights that are super fun
>>575394221Being a edgy creepypasta mass murder is a lot more interesting than "omg le hecking Noelle loves... (YOU) instead of suszy?!?!!?? what the FUUCK!!! its like... shes in a video game?!"
>>575394329
>>575394091>actual face is the same as the projected facecharacter design is my passion
>>575394205Unless you look like this I don't want you
>youtube video talks about the dynamic between kris and the player>leaves out everything about kris working with the knight and being bound by a promise>only focuses on "the player is puppeting kris and they don't like that"It's fucking 2026 man come the hell on we're not stuck on Chapter 2 anymore
>>575394329anon this is the 8th time you shown dess knight without butt armor to /utg/
>>575394513who said I wanted to be ralsei
>>575394489Imagine the smell
>>575394489
when dess braps up a storm and her fart emissions cause the battle arena to fog up and color our soul green
>>575394791but anongreen means clean
>>575394698kris is a helpless victim
>>575394791so that's why they call her the Roaring knight
>>575394489why though
>>575394543i'm glad we aren't the primary agent of the plot in deltarune, we already were in undertale. how fucking boring would the game be if it was that and the only takeaway was how evil we are for playing at all?
would kris and susie be able to stomach the gaster asshole donuts
>>575395010bringing these to the meetup
>>575394993feels good man
>>575394489>"Haha that's pretty funny, let's check out their other ar--"> "oh good heavens"
>>575395042Men at the meet-up won't put donuts on their cocks just because you asked nicely, anon.
Is it just me or the flowers feel particularly like woke DEI?
>>575395010who gaped him?
I like art where flowey is just wrapped around someone while they go about their day. Hes like a purse dog but clingy and mean
>>575395145i'm not asking, i'm telling
im so fucking tired of this green bullshit.GASTERISYELLOWHE IS YELLOW MELLOW FELLOW!!! YELLOW.SANS IS BLUE, PAPYRUS IS RED AND GASTER IS YELLOWyellow. Yellow! YELLOW!!!!Y. E. L. L. O. WELLOWget it right you IDIOTS!!!!
>>575395005I think I wouldve preferred that to "You are not allowed to actually learn or progress this story meaningfully because I, the protag, dont want you to and hold most of the cards"
>>575395085???
>>575395218I might listen to that. At least if you bring a dog collar as a gift.
>>575395152its just blue
>>575395042I am so down to try them but they're a fucking midwest thing fuck you the whole midwest area
>>575395010gasters secret bunker donut
>>575395152yes anime has no place in deltarune
>>575395152even the cunny flower and pink catgirl and retarded mouse and flowery?
>>575394489>>575395085Holy shit I LOVE HYPERFAT!!!YOU HEAR ME /UTG/? I LOVE IT! I LOVE HYPERFATTTTT...!!!
>>575395152
>>575395152havin fun in the wow thread?
>>575395085what's the @
blue actually feels like the token black one.all the others(butflowery ig) can be seen as white or tan or black (even yellow) but Blue is just so painfully the black one that was made to look blackt-that's not a bad thing or anything!! I actually like them even if much much less then any of the other flowers!
Is the voice in the code in the unused script supposed to be Dess' mind/her memories of Noelle and everything while the Knight is using her body like a vessel?We've already had multiple instances of the mind rebelling against the body (or vice versa) in Deltarune before.
>>575395521radaranomalyvery fat art
>sacrifice school budget>increase police funds
flowey doesnt take the souls in geno because he actually has no idea where tf they areyou're meant to do geno after a true reset so he doesn't know where Asgore keeps them he was probably trying to get Aagore to tell him before Frisk showed up
>>575395531Toby really had to emphasize he’s black by having him be the only other flower besides flowery to have a dialogue portrait
fave forgot we moved to new thread
>>575395690asriel killed dess because she got preggers with his chiuld but he wasnt ready to be a dad
>>575395634The only way for the dialogue to NOT take place years ago in-universe during the original Dessappearance is if there's time travel nonsense that warped her consciousness forward, because Chapter 1's unused texts are clearly from the perspective of someone who only recently ended up where they areIf the alternative to it being a flashback is weird time travel shit I'm more inclined to believe it's a flashback
https://youtu.be/v7GMG1aLyPw
yknow for someone who lost her daughter and is about to lose her husband too Carol has been reasonably well adjusted
>>575395010Soda cakes are actually pretty dank so I imagine donuts made the same way are pretty good too. I make them while camping.
Toby made Blue black last minute because he realised that the japanese aesthetic + recent drama was kind of a bad look so he wanted to dodge any future allegations by making a black character to show how much he cares for blacks and shitofc he didn't want it to be any of the flowers he actually cared about so he picked Blue whose the most boring flower
>>575396221cute
Don't forget jaronabox is happening now come join when the round is done
>>575395892The only thing Asriel killed is Dess' cock from choking on it too hard.
>>575395048This is really good but I thought he was doing this
do you think Noelle would play a sport like softball or something? she’d be cute in the uniform
>>575395892and the child's name... would've been ralsei....
>>575396102She still has a daughter to care of.
>>575396508hideous bushy eyebrows crooked teeth creature
>>575396508that's the husband. wife is the pink one
>>575396374where.......
>>575396473she is in track
>>575396317you gotta be careful with this or you may attract people who actually genuinely believe stuff like this
>>575396473she should play in the wet t shirt contest competitive division
do you think ralsei would be a cheerleader? he'd be cute in the uniform
>>575396551yes.
>>575396603>>575390921
>>575396102The woman who has turned cold and controlling because she continues to lose everything that matters to her, for reasons beyond her control, is pretty tragic in itself.
>Ralsei is Dess' aborted fetus stuck in the pipes below the city's sewersHOLY. SHIT.
>>575396102she's on the brink
Writefagging is so embarrassing… please don’t infer anything about me from how fervently Y/N shoves their tongue down faves throat…
>>575396680yeah he would
how could Ralsei be Dess's aborted fetus if Dess is Papyrus?
i realize i've forgotten most of the game because what the fuck is this
cheerleader ralsei...football star susie... school shooter (probable) kris...
>>575396818>faves throatnnngghhhh
do you think toby would make dess trans
>>575396898>papyrus is missing>dess is also missingDamn.... He's got a point....
>>575396787Why is Carol on the SAW bathroom
>>575396787I love this person's Carol
>>575396898that's how the fetus died
>>575396970berdly Berdly
Would Carol love western animation?
>>575397151uhh berdly and his harem comprised of um *checking notes* catti and toriel
>>575396508God yes Maddie's goofy faces are a trillion times cuter than darkner mew's and I don't want her trademark retarded faces to go away. I hope you can still see them in the light world or something.>>575396551Dreadful fucking taste.
>>575397057>hello zepp intensifies
>>575397151The bird nobody invited:
i used toi think it was "berdley" like a play on "bradley"
>>575397027I'm not entirely opposed because Dess could use some conflict in her life and the rich girl with a loving family and friends kinda makes this difficult
>>575397251toriel doesn't like berdly and makes fun of him
>>575397108
>>575397151berdgroomer...
>>575397042You know what else?>the roaring knight looks like a skelington>papyrus was going to be in the holiday house if hussie's bust puzzle was implemented>bone trousle and black knife start with b'sAnd before we Don't ForgetTHEIR DOORS ARE THE SAME
>>575397281i think it is berdley and we're all just mispelling it
>>575397417thats dess' clkoset door.its just implying dess has skeletons in her closet
>>575397265He has to invite himself because nobody ever reaches out or expresses interest to him>>575397281A lot of people do desu. I've also seen "Birdley", albeit rarely
>>575396904the HOTTEST shit in that entire game is what it isfinal fantasy reference
>>575395245we are learning though, albeit slowly, and you have to dig for most of it. and the story literally doesn't progress without us, because we are essential to what kris is doing.being the primary agent of the story necessarily means that the protagonist is a puppet for us, but if the protagonist is written as a character distinct from player action, they're no longer a puppet but a hostage. frisk being a non-entity, despite being named and made distinct from us, is one of the most glaring oversights in undertale's metanarrative. kris is far more interesting than frisk because they definitively aren't us, and frequently resist and use us to their own ends. the fact that either we are kris's hostage, or that kris is our hostage in the weird route, is one of the most special things about deltarune. the closest i've seen to another game doing the same thing was OFF, but OFF didn't explore the idea as much as deltarune already has without even being finished yet.
i'm going to the undertale symphony later in the year
awww you know me so well
>>575397417>Dess was DtS (deer to skeleton)>S(he) ran away from home and was taken by Dr. Gaster who successfuly made her transition into a skeleton man>Sans won't let you see her because s(he's) not ready to come out publicly yet
>>575397591I'll smell you there
>>575397530Do not check the average age of this man's discord dm list.
>>575393606is this the childhood's end dev?
>>575397529PAPYRUS WHAT ARE YOU DOING IN THAT TEENAGER'S CLOSET
>>575397613we're all autistic here
anonymously post what concert you're going to so i know if i'll be near any of you
Ohio my fellow nee-hongos
>>575397684be careful not to get too addicted to my pheromones and lustful scent
>>575397697is this a bit or are they actually a groomer lmaoo
plapping anon's ass at the undertale symphony later in the year.the music is gonna drown out the moans so nobody is gonna notice!
DELTARUNE IS A VIDEO GAME
fave had food delivered and the fountain drink tasted like straight carbonated syrup
>>575395910I think times just fucked in the deepest dark
>>575397879make sure to do it in rhythm with the symphony
I used to listen to this constantly as a kid, that takes me back https://youtu.be/dJDCoOIy6PI
>>575397805who you callin' honko?
>>575397969i hope fave tipped the floradinn that delivered their slop
toby regrets making your fave btw
Non-zero % chance anons get laid at the concerts… giwtwm
>>575398094tip? I'm giving floradinn the whole lenght.
i want to attend the concerts but they're mostly going to be kids
>>575398117not if they don't tell me where they're going
I should have guessed the gay drink.
>>575398107I think he genuinely might :(
>>575397861Yeah they had a messy breakup that lasted for years somehow. https://arch.b4k.dev/vg/search/text/So%20True%20Lexi/
>>575398225the real ones will know...
>>575398263fuck you
>>575398320I broke the iron rule: Always guess gay for tf3.
>>575398263margaritas aren't gay you homo
Sethfag is going to jail
THERE GOES MY VALENTINE AGAINSOAKED IN RED FOR WHAT SHE SAIDAND NOW SHE'S GONEOH MY GOD HAVE I DONE IT AGAINTHERE'S A PULSE AND IT'S DEAFENINGI CAN'T HELP WHAT I HEAR IN MY HEADIT'S A SWITCH THAT I FLICK THEY SAID(HAND OF BLOOD)I DON'T WANNA FEEL, MY HEART IS BREAKING(HAND OF BLOOD)I DON'T WANNA SEE, MY LIFE IS BURNIIIIIIIIIIIIIIIIIINGI SAW YOU LOOK AWAYYYIS WHAT YOU'VE SEEN TOO MUCH TO TAKEOR ARE YOU BLIND AND SEEING NOTHING(I SAW YOU RUUUUUUUUN)I SAW YOU RUN AWAYYYIS WHAT I'VE DONE TOO MUCH TO TAKEOR ARE YOU SCARED OF BEING NOTHING
To quote berdfag: "SHE WAS LITERALLY 17 YEARS OLD YOU SICK FUCK!HOW COULD YOU TRADE ONLINE MESSAGES WITH HER!?! "https://arch.b4k.dev/vg/thread/438017714/#q438030030
>>575398456they asked me to do it!
>>575396473>Noelle>SoftballSo basically this
>>575398204ut is 10 years oldhussie is 50deltarune is also about to be 9don't worry about it
Are there actually people who don’t like Chara? She sacrificed herself to free monsterkind and instead gets viewed as some mass murdering gremlin when Frisk was the one behind the genocide route, if anything Chara should be more liked than Frisk for actually having lore and ambitions
I couldn't think of a good answer in time
>>575391864Sick painting
Toby must be ashamed of 50 years old grandpa Hussie going around in Gaster cosplay
>>575398513Now I have even more questions than before
>>575398578dont slander my aura farming goat frisk he solos your verse and rapes your fave no diff
ahahagha
>>575391864This rules.
*laughs in 26 years old*
>>575394513I want to press his button asshole up against my face
cowwectly>>575398843i'm an open book!
can we do the jackbox game where we finger fuck eachother to death?
>>575399020Big or small dick?
dwinking is scawy i agree, i don't like feeling stupid
When chapter 2 dropped I used to walk to and from work listening to Love Bites by halestorm and imagine krusie scenarios. This went on for like a solid month.
>>575398924Damn unc, why are you still playing videogames at this age go pay child support or something
>>575398578>Frisk was the one behind the genocide routeit was (You), anon. frisk doesn't do anything for the whole game besides say their name at the end of true pacifist.
>>575399046technically barely above average!
>>575398578Frisk is better than Chara and both of them should be above Kris.
>>575399035*swallows your arm up to the elbow in my cavernous vagina* I win
>>575398578chara sucks and almost all chara art is 90% headcanon shit that never happened
I didn't do anything all day. I should kill myself.
>>575399020where did this take place? why were you asked to do this?
>>575399035what???????????
How do I kill the flower man and put him out of his misery before the knight gets to him?
>>575399195the vaginusmus viscount....
>>575398863*she
im gonna practice drawing today. i hope i can learn to draw hair eventually, maybe i can draw kris
>>575399265That's the opposite of vaginismust. vaginismus visualizer.
>>575399035come over
>>575399261Don't knock it till ya try it piggy.
>>575399220happened during thanksgiving at a friend's house. there was a lot of alcohol involved.
I'm sorry I don't know what the fuck I was doing
>>575399330I don't self insert as women
Why do all of you type like you are 20 years old?
>>575399020Did you finish? What happened afterwards?
>>575399376Did you have an orgy?
I want to pollinate this loli
>>575398837toby is a granny himself
>>575395152Toby fox is… woke?!
>>575399483we are
>>57539892432...
>>575399616>I’m oldPlease start throwing hammers its destiny
Now that the dust has settled who is the absolutely gayest character of UT/DR?
>>575399479You're not supposed to self-insert as Frisk
>>575399486>>575399489yes, and yes! afterwards, we did the "literally me" quadruple feature, where we watched american psycho, fight club, drive, and bladerunner 2049. it was fun!
>>575399740rg1 and rg2
>>575396701Can you participate in this without doxxing yourself?
>>575399759If mexicans self insert as goku i can self insert as frisk
i wish i was painter
sphinxtummy...
>>575399740Nicecream
>>575399787Were any women involved at all? This sounds extremely gay.
>>575399740
>>575399815yes
>>575398578as you can already see yes chara is still not really universally well liked as a character at all. you just have to breathe in the direction of the hornets nest and suddenly its 2016 again with how badly some people will dunk on them, but then also most people just don't give a shit really
>>575399831its hotter without the costume
>>575399896a little over half!
i wish i was carol
KRIS WHY WOULD YOU DO THIS?!
I miss painter
>>575399831*rubs your big fluffy $$$$-ing tummy*
I want to eat carolanon out so fucking badly
>>575400036Buckets of blood gotta come from somewhere
>>575399950>its hotter if its just a regular personno
kiddo why did you kill the earthbound snake in deltatraveller...... that snake had a family........
>>575400114who said anything about regular? the head can stay on.
>>575400036mothersisters... our verse is fodder...
I love my they/them spouse
>>575400036ch2 era mods were so funny man
I want to eat carol mmm reindeer
i hope berdley has a good family because the more i think about him the sadder i become
i wish painter would post more of her body
>>575391748
>>575399530How old do flowers have to be before they can be pollinated?
>>575400280rubbing her fat tits
>>575400280this but with barafag
yeah, ralsei is a “girl” (goat in real life)
i swear i'm not the alien my enemies are framing me
>>575400036https://www.youtube.com/watch?v=iv_UV5ATRhYApologize.
Berdfag got real quiet after getting quoted about that 17 year old he was trading online messages with.
>>575400353angel spamton…
Painter abandoned us, get over it.
>>575391864ralsei likes the first descendant?
>>575400262I wonder if anyone here's actually eaten reindeer before and how it compares to regular venison. I'm sure it's normal to eat reindeer in like Finland or some place like that.
I wish we could explode brains through the screen so I could never have to accidentally run into an annoying Trans Ralsei faggot
>>575400387This is true
>>575400323one last fun adventure..
i hope asriel took a turn forthe worse in college and comes back basically a flowey
>>575400457gee why would any artist abandon the general full of thread spamming schizos who go after anyone who draws
dooood why are aliens so op nerf them jack box corporation
>>575400503>Kris but they are 5% more green.
>>575400441My cock YEARNS for the mantis geisha
>>575400550I guess she got her period or something.
>>575399816Spics are retarded, though.
dess trying doing what noelle did to kris at the lake but with asriel but he refused and left her to drown alone
>>575400597they're getting healthier
>>575391521you did chose to not parry flowery right
>>575400484>transphobia blastWatch what happens when I cast a spell I don’t know
>>575399612Then why are you here and not being banned for being underage?
>>575400695anon......
>>575400550She’s miles better than everyone here why would she care
>>575400695>bites the lock off
so... why arent the bugs like the mantis, beetle and muffet in ch5 not lightners?
>>575400706look, it was the heat of the moment...
>>575400695So hot.
bro
>>575399804Whomst?
boo!
>>575400706Yeah, the "quick" time event was so slow, that it was practically begging me to intentionally fail
imagine being stuck like this forever lol
>>575400695>not a flat cagelame.
i should've known, i'm sorry
>>575400838This is my one and only time i can say with 100% certainty that it’s actually a bad writing/ plot hole moment
Stay in your cage next time you disgusting freaks.
>>575400769artists of any quality don't like hostile environments
>>575401008who
>>575400706GOTTA WIN
>>575400695Wish there was art of the red soul as Kris' chastity cage
>>575400550She had a fatcave diving incident and is still waiting for Gaster's rescue team to recover her from the DEPTHS of Tenna's undermoobs, which rival oceanic trenches. Tenna has four arms and multiple rows of teats like an ant cow, so extraction is even more challenging.
>>575401008>janny started his passfag spam at the endkekafreckleheckleshecklemeckleprecklewazeckleroopyhoopyskoodyroohoohoooooooOOOOOOOOOOOOOOOOOOO!!
>>575400695source
faggot man faggot man with his dick in your ass
>>575400864these dudes
>>575401112p-painter... is it really oyu....
>>575401245best post in thread
i wish i had schizos coming after my drawings the drawings i wish i could that is...
>>575401245This raped /v/ mods
i thought that said "never showered"!
who wants to touch my fresh out of the shower body?
>>575401443How big is your penis?
So there's only 4 active actual drawfags and 2 scribblers. Thanks chapter 5!
>>575401443meeeeeeeeee
>>575401245they look happy and ready to be reduced to dusty powder
>>575401245It's really hard to fault gay guys that are Macho gay for being so gay.
>>575401443How long is your pussy?
>>575401245I love bara so much man
>>57540123810 INCHES DEEPTHE FAGGOT MANIS WAITING FOR YOUR COCK IN HIS HANDSSPRADING LEGS OUT WITHOUT A PLANLIKE THE EVERY DAILYPORN THAT TURNS ON THE FAGGOT MAN"COULD I DO SOMETHING TO MAKE HIM CUM?"INSIDE MY LITTLE BUTTHOLE MADE OF DRAMSSO HE LIVED THEFAGGOT MANFAGGOT MANWITH HIS DICK IN HIS PANTSSO HE STANDSTO JERK THE ENTIRE THREAD WITH HIS HANDSWAY UP HIGHIN THE SKYWITH A COCK IN HIS ASSAIN'T IT NICE?THE LIFE FOREVER FOROP
>>575401469like 6 inches
>>575401443Hey, I just got out of the shower too.I jerked off.
>>575401490where would you rank this
chapter 5 gave us barafag so i'm happy
>>5754015878 inches here you've seen it before so how about touching it this time?
>>575401692me on the bottom
is anyone else going to move into the /utg/ mansion with me
>>575401692being desperate for attention puts you lower
me the bottomgetting railed by dick
>>575401693Death to newfags
>>575401490Define actual drawfags
>>575401756do you wanna be my roommate?
>>575401781death to (You)
>>575401778Who's Dick?
>>575401693I was here b4 that silly made a few asgores for the asgores guytho ch5 did make me come back so... anyways is the current wb a new one? i should do my ritual sex drawing right about now
I don't hate you guys.
If the dark world is this magical place of pretend of fantasy, why cant Kris use magic but everyone else can?
>>575401692Lowest>child’s drawings>definition of attention whoring
>>575401826only if I can be the little spoon
>>575401870me neither
Need a tall deer gf
>>575401692Lvl 0 Moid Scribbler
>>575401906deal *snuggles you*
who are the drawfags exactly? which ones are named?
>>575401692we wouldn't notice if you stopped posting
>>575401258No, I'm a filthy wordfagmoidspoid
>>575401490What scribblers? I thought it was just the one attenton whore guy
>>575401870I do
I lost all my shit because my computer decided to kill itself one day. NOBODY WILL REMEMBER MY MOID SHITS!
More like drawstraights.
>>575401870neither do i
Ten feet twenty the flower manIs waiting for the touch of his handStraightening pedos out without a plan
i think you're all pretty neat!
>>575401692I like it anon
>>575401940
>>575401693>say you're a newfag without saying you're a newfag
>>575401870I am glad to have people to talk about Deltarune with but by God are some of you fuckers obnoxious as hell.
>>575402097Is she stupid?
lol
>>575401692Cute
BEST OF FAT FAVES OH BEST OF FAT FAVES
I actually did get up to complain at a movie theatre once, but it was because the projector was broken.
>>575401824People who know how to draw
>>575402374Give examples and counter examples
>>575401245>>575402310See now this is what an actual gay faggot looks like and enjoys.
im so fucking fat god damn it
you know it, bro!might get banned for this one...!
Imagine Noelle and Kris try and cross the lake but it isn't even deep enough to go up to their chests and Noelle is bewildered why no one has tried this before.Then they go flyfishing.
GREAT MINDS THINK ALIKE
Great thread, awesome thread guys, keep it up
Noel shouldn't have been a twink/twunk, he should've been a bara.
if people want more drawfags why dont they start drawing
>>575402435Sorry bro your scribbles sucks, but you could still cosplay as Tenna
>>575402540More like meat minds
people who draw in the whiteboard and make it look good despite being a fucking whiteboard are drawfagsbonus if they're not using paid features
>>575402443I jerk to bara, chubs and hyperfats, so according to this general I'm a thoid because the most notorious fatposters here are female and baraposters are male.Don't put all fags in one box like monsters in the Underground.
>>575402572the cord will make fun of you if you do
List every single drawfag active right now and if you don't remember me I'm going to LOSE my FUCKING SHIT and you aren't going to like what happens!
im hungry im gonna go and mag later
>>575402671>There's people paying 7.90 dollars a month
I'm liking the energy in here rn..! so I'll just ask...any requests?
Bara inspires me to workout
>>575402572the last time i tried drawing it looked so dogshit that i was too embarrassed to ever attempt it again
>>575402732i wouldnt make fun of an anon, everyone is bad when they start
>>575402435>examplescarolanon assbro>counter examples >>575401692
>>575402528imagine its the opposite and neither of them know how to swim so once they get too deep they just have no idea how to move in deeper
>>575402869Noel but Bara...
>>575402869please draw chinese image friend
nope, we're not doing this
>>575402869Buff Aqua
>>575402435>examplesEveryone but me>counter examplesMe
how do i get back in /utg/'s graces..
>>575402869tenna twerking
All good request actually but why does the image friend gotta be "chinese" specifically?
>>575402915>sans in an inner tube with a lemonade giving them pool floaties to help to swim
>>575403112because it's already been drawn as black
>>575403112There may or may not be a running gag about IMAGE_FRIEND pretending to be chinese
>>575402819if it were like 3 bucks i could understand it but 8 is crazy
>>575402715I don't understand a single thing you just typed retard
>>575402869Aqua stealing Seth's underwear
This is Sans with Frisk in the last corridor
>>575402819It’s just one guy and he’s doing it for the feature that lets you download the finished canvas at high res
>>575402884but anon everyone starts out being embarassingly bad, you can still have fun even if you're really terribleim sure you can feel proud of yourself even if you dont like the finished product
>>575402620Imagine a netskie turning you into one of them and then fucking you into submission, leaving you a mess on the floor completely helpless to do anything as it walks away wearing your face and stealing your life, forcing you to whore yourself out to the other netskies in order to make up for your faulty shapeshifting powers
NOW'S YOUR CHANCE TO BE A [[HUGE FAG]]
I'm fucking up in jackbox because the stream delay is bigger than I think...
>>575402884The secret trick is to make illustrations that are meant to be funny. You'll care a lot less about if it looks objectively good and much more about if it conveys the joke. You're only looking up the technical aspects of it to improve the joke. Pursuit of being funny is a lot less humiliating than pursuit of making things that look good.
Okay fine. Maybe I would have sex with Yellow. Whatever. At this point I guess I'm willing to fuck anything
>>575403534its delayed for me too but you get used to it
>>575402869Noelle playing sports
please please please what do i have to do to earn a drawfag name its been a year
>>575403580i wish i was funny...
>>575403762why is gaster fucking friend
>>575403663*unzip*
>>575403810>he doesnt knowthey dont call it friend inside me for nothin
I just kinda give up with theories until the full game is out.
why is friend latinx now
>>575404000friend has become transtinx
un amigo dentro de mí
>>575404000friend is a ni
Six foot seven the tung tung maaannnnnn
Milklooker tf fetish pics when?
Freak freak freak family (Your family)
>>575404132You shouldn't call your friends "nimrods"
>>575404132That's Blue Floyd though
>>575403202I was gonna pick noel but ok you won just because that made me kekgimme like a minute... in the meantime you can have this wip for an unrelated comm im doing I thoughtI knew my game but that whitebord taught me some stuffhttps://litter.catbox.moe/xqw4sv.png
i'd need at least a minute to make it worthwhile
I could finish to Aqua in 10 seconds
>>575404198FREAK TOWNFREAK POPULACEFREAK PLANET
i would give seth many kisses!
oooo lalala thanks for jacking.binch
At least I got to play that last game, thank you guys
Spookydood is such a retarded faggot
Janigga!
>>575404264they have furries in australia? what a world
>>575403306Tenna when Spamton tries to show him what an email is:
>>575393181Anon i know I'm late but I love this. It's so cute. The power of fluffy boys and mean girls is actually shining down upon you
>human with a sword, or knife>human with a staff, or stickChara/Kris and Frisk/vessel
>>575404264you're really good thank you for sharing
i wish MY fave was real for 10 seconds a day
dood i literally need your protein like im literally not tryna be funny dood - latinx friend
magma time now please
>>575404404eh he’s better than the other deltaqueer theorists
>>575404380thanks for coming, join us next weekend if we play xoxo
thank you for watching my jackbox dream
>>575404190Sorry, they expired and had to be tossed. We only got Ficus Licker and Elder Puzzler
>>575404551thank you for watching me jerk off.
>>575404456that means a lot anon thanks, the power of fluffy boys and mean girls shines upon us all!
>>575404604What the Fuck goes on in the jackbox streams
>>575404496>APARATO_AMIGO
>>575404568For a sec I thought Carol was rubbing caterpillars on her face
>>575404432believe me there's plenty of aussie ones lol>>575404474cheers!!! I'm proud of it so I'm glad to share even if it's not ready
>>575404692fun!
>>575404518He just makes videos based on whatever theory is currently trending on Twitter, how is he better than other theorists when all he does is repeat what they say?
GLUE!
>>575404568aw
I'm in love with Spamton.
It seems very obvious to me that Kris is some sort of sexual violence victim. The therapy, the avoidant behavior, their muted reactions to everything. So much seems to be pointing in that direction. The heavy focus on how their relationship with Noelle was "forced", the Spamton storyline where Spamton tried to corner Kris in the Blue Queen's basement because he wanted to claim Kris's soul for himself, Noelle's attitude towards the real Kris in her weird route breakdown, the way Carol talks to Kris with almost this uncharacteristic intimacy and is secretly phoning them at night, Carol's obsession with heart shaped objectsEven Kris's relationship with the Player and the Knight could be read as rape metaphors. I really don't think this is as all simple as Kris saw Dess fall in to the darkness or was spooked by gaster penumbra phantasm in the forest or what ever. This has to be something incredibly personal
>>575400036is this deltatraveler?
>>575404568damn those hands are incredible. youve really been going off on hands lately I've noticed
>>575404518The only one he's better than is Jaru because Jaru is bottom of the barrel garbage that somehow managed to outretard him
>>575404404did you know that he privated the dess sucks video and his most recent video arguing for carol knight has 3 seperate "we're all having fun here don't be mean to me" disclaimers
cute raly
>>575404404>>575404775Are you one of those retards that can't cope that the twisted sword is not actually removing trance?
>>575404734terrifying
i had an australian furry friend once and all he used to do was blow his money on designer clothes and heroin. kinda based
>>575404132Niña
>>575404568you're really good too thank you for sharing
>>575404692Nohting special, we were just watching people jerk off in front of a crowd
>>575404973 I don't have any strong opinions on what the trance stat means and I don't even remember watching a video where he talked about itI just think spookydood is a retarded faggot for his content in general
>>575405013sounds like he was living the dream
>>575397805おはよございます!!
>>575405101decent background noise though
>>575405098you're invited too, anon!
This is one of the oldest whiteboard images I have saved
>>575404902I truly just don't think toby would write that kind of story. The signs are there, though. I do think something happened that Kris couldn't "complete" their therapy for and they were certainly being dragged in every which way by the Holiday girls but I don't think it was SA
hey kris remember when dess used to GROOM you
>>575404973I already said that I don't like his videos because they just regurgitate theories from Twitter. I don't have any issue with the content, just the fact that he makes clickbait slop out of other people's ideas. Some of the theories are dogshit like the fool's gambit and Wachifield videos, but I can't even attribute those theories being dogshit to him since he's just copying shit from Twitter.
>>575404902dess pedophile groomed them on aminobut actually i would not be surprised and itd be good for the plothonestly i think maybe dess used them for some kind of weird route like they used noelle and it's a sort of repeating their trauma type thing because there's absolutely no way in 100000 years that canon dess actually groomed kris (in a sexual way at least, she definitely groomed them though)
what do i draw im artblocked like hell
>>575405469draw ralsusie
>>575405469radiation fox
>>575405469>>575404851
>>575404459>Frisk/Vessel is the feminine one
grooming is completely out of place in a toby fox story and the only people who think otherwise are gaslighting themselves to pretend it's not for gooning purposes
Noelle DOES have the personality of a rapist. She treats every friendship she has transactionally. That scene at the lake was the first time in her life that she ever truly smiled (this is canon). Berdly and Kris were both just convenient people she had to keep her entertained, and she very quickly tosses both of them aside at the drop of a hat, both in weird route and normal route. Susie is just a surrogate Dess for her and doesn't actually bring her any real satisfaction, everything with Susie is just Noelle following her preset path. She would 100% rape someone not for pleasure but just to enforce her own autonomy and control over their person
>>575405469Your fave dancing, spinning around in a circle or fishing, maybe even all three at once
>>575404924>>575405096thank you. hands are very emotive in their own right so I'm always trying to draw them better
>>575405469dess pedophile grooming kris on amino
>>575405420Still better than you
>>575405452the shit we see happen ingame is already grooming but I don't really expect Toby to bite the bullet on actual sexual violence. It's not entirely needed anyhow, it's enough to say Dess and Kris were romantically involved
>>575398107Onionsan lover saying this sadly looking into a mirror
>>575405469Aqua kicking her legs while floating
>>575391521Seam Beam?????
>>575405596
>>575405596That’s psychopathy/sociopathy not “being a rapist”
>>575405469Draw my boyfriend battat
>>575405782Jackbox noelles are pretty neat ngl
>>575405714with upskirt if you are super based
>>575405596Noelle would say this about herself and then when Carol tells her to get ready for the belt she'll cry and beg for her life
i'll doodle something after i brush my dishes and clean my teeth
>>575404530>two in one schizo gf dealsign me up
>>575405420I despise that he takes theories gaining traction on Twitter and renames them to 67 tung tung tung sahur theory for clickbait purposesIt ruins discussion of them forever. Gaster's non-gonered primary color being green actually makes sense and has decent hints throughout the games but oohhh no it's a CRACK THEORY now because he called it fucking 67 theory and now it's synonymous with that so it's a shitpost forever
>>575404902>Even Kris's relationship with the Player and the Knight could be read as rape metaphors.Playing a video game is just like raping its teenage protagonist
https://strawpoll.com/XmZRQo32wgd
>>575405937Good anon.
>>575405672Oh, anonymous, you've wounded my ego *kisses you with tongue*
>>575391748Reposting the fixed version. I keep forgetting the texture and a few other small errors.>Did you see it?
I love you
>The stars were beautiful, Kris thought to themself sitting outside the school>It was late, any sane person would be at home sleeping at this hour>Yet Kris could not sleep, not after today's events, they couldn't close their eyes even if they tried>All they would see is her face, smiling with an incredible power they could not describe with mere words>Susie's smile, which they once considered the most beautiful thing in the world, was never theirs to bear witness>Never was it for Kris to be held in her arms, comforted and saved from a terrible darkness brimming on the horizon, a final sunset of which an unending night would blossom>Yet... even the darkest night still shined with stars, thousands of them in the sky of this small rural town they called home. they could not compare to the natural awe of the sunset, but they were to be appreciated nonetheless>And so they smiled, gripped their face, and cried to themself, a silent night filled only with the anguish of a broken dream>They cried and cried to a love that would never come running, a comfort that would never be returned, a love they might not even deserve at all>They cried until there were no more tears left to fall, and all that was left was the silence of yet another night alone>Kris knew mom would be worried sick if they didn't come home soon, so they got up from the tuft of grass they had been laying in, and went home>All that was left in their place was a small, clear shard of glass>Inside its vantablack shine was Kris in Susie's arms, smiling as wide as they could, watching the sunset together from the lake, a view into what could have been if only things had gone a different path
>>575404902stories are fun because you can interpret them however you want. however you also must also actually read the text under the rules of its author and all the text that came before what is informing your interpretation. it's like niggas who think dess ISN'T the knight. er, what?
>>575406103if you really loved me you wouldn't have forgotten our anniversary.
>>575405583The player is canonically female so it makes sense for the vessel to be feminine
>>575406082I'm not a faggot, you don't need to do the gay erp smarmy shit nigga
if dess actually pedophile groomed kris on amino, why do they keep seeking for her? do they have a stockholm syndrome?
Flowgore just isn't interesting if there isn't psuedo incest vibes. Flowery has to make Asgore uncomfortable as fuck by trying to be his bf and son at the same time.
>>575405452Maybe Dess pressured Kris into going onto all her dark world adventures so that they could seal the fountain when she was done, even as the adventures got scarier and more violent. Could work as a good metaphor while not getting too close to the real thing, with Dess using Kris' soul for her own please
>>575406254>I'm not a faggotLook where you are
>>575406269Even if Dess did literally groomed and raped Kris, her lack of presence still more or less destroyed not only their family, but also their relationship with the Holidays, so theoretically, bringing her back should fix that.
i love groomer or "pushed kris' limits of comfort" dess but i hate the sexual element so much
>>575406284Asgoreanon you post the craziest stuff sometimes
This should make a resurgence https://www.youtube.com/watch?v=1KQhq5B3g94
Is snapcube a tranny?
>>575405684if the knight is actually dess kris was 100% groomed and is just still attached to their groomer, if not i can see it being read as them just being super traumatized by green pirate gaster or whateverunless they turn out to have like a super big awareness of the plot i guess, beyond that of the knight's, which i dont think is super likelyhes not gonna say they were romantically involved though, i dont think toby likes that sort of thing but itll probably be my headcanon till i die
this faggot is pathetic
>>575406454thisgrooming is not only about it being sexualstill doesn't make it any better though
>I don't want anymore Underrune games after Deltarunewhat a sad sad pessimistic group of people you all are
>>575406484yes and also a pedophile. big shocker there im sure
>>575406462I'm not asgoreanon...
>>575406454same, sexual grooming stuff should stay fanon but groomer dess would be peak writing
>>575406629is this because they play roblox or do they do weird sexual shit with kids?
>>575406570Toriel get off 4chan and go protect a human correctly for once
Even if Dess is the Knight, the Dess-Kris relationship will probably resemble the Chara-Asriel relationship at worst, not actual grooming.
>>575406629wait snapcubes a pedophile??
>>575406761>Kris is who convinced her to become in the Knight in the first place and that's why they feel so convicted to save her or whatever
>>575406730>>575406762babyfur
The gray place in MANCOUNTRY is where Kris and Noelle ended up in Side B
>>575406868>I'm gray da ba de da ba die
>>575406429on 4chan
fingers in his ass sort of ruins the asgore fight for me i'm done for tonight
>>575406864I dont think that necessarily makes you a pedo unless they're intentionally mingling with real kids trying to pass themselves off as one.Disturbing sure but that's about it
>>575406103ilu2
>>575406454Well you're not supposed to find the idea sexually gratifying by default. Deltarune works off Homestuck or Prequel logic where it presents topics asexually under the full knowledge the audience will create the sexual content for them.
>>575406868whats mancountry
Beautiful comic, gave me chillshttps://x.com/GOOMYLOID/status/2081429764217151771https://x.com/GOOMYLOID/status/2081429767232868702https://x.com/GOOMYLOID/status/2081429776145809665https://x.com/GOOMYLOID/status/2081429782206583125
>>575406864So not a pedophile then
ch6 spoilers
>>575406761ehhhh its still a pretty iffy relationship since dess is like way older than them, like did you have to get really close with this little kid and bring them on your weird adventure instead of like bringing your boyfriend?
>>575406868there'd be nothing to do there though
why didn't toby give this to me https://x.com/pykoma/status/2081222119992484073
>>575407173ah yes, asriel and his infamous blackbox
I wonder if the carol artist ever read that really depressing post wr comic where carol kills herself and sees a vision of kris and her family on the piano
>>575406770Poor deer
>>575407173mewtroons are scraping the bottom of the barrel now
>>575406761>>575407186not many ways to interpret a secret promise between a grown adult and a child that actively causes said child to self harm while giving them intense OCD
>>575407186That's assuming that Dess intentionally brought Kris rather than Kris following her around like little kids often do
>>575407257Post it, sadness fuels me. Peek for next painting.
>>575407257>>575407401I posted it earlier >>575397108 >>575397324 they get it
>>575406615Why shouldnt toby move on to something fresh? Deltarune is his magnum opus it should be able to put a bow on everything he wants to do with the setting
>>575407186it's a game by toby fox. in these games kids can enter local inns and get rooms to sleep in for free you're taking a dark and edgy spin on things
>>575406615I genuinely do not want another 10 year long wait to a story that already seems to be wrapping up
Dess can't be more than 3 years older than Kris bro. Toriel says Kris is about to go to college too when Asriel's a first year. It's not weird for a 10 year old to hang out with a 7 year old.
if this game gets a heartbroken dess ending im gonna fucking lose it
What if amalgamknight turns out to be real though
>>575407129doe women be crazythe contrast between the heartfelt comic and the comments where the artist is going "whoops teehee sorry for party rocking :p" is funny
>>575407173His ass is huge
>>575407129i just can't give 2 shits about kriselle
>>575407627he uses it to entice human men usually
One day, sooner than you imagine, Deltarune will be over. What will you do then?
>>575401245oauygh
>>575407665hopefully still talk to my friends here if they want to be my actual friends
>>575407354okay well she wasnt a grown adult but she was like way older than them, still fucked up>>575407394i think she needed kris to be honest, also assuming raise up your bat is about dess since shes the only one who uses one and roary uses one in the same chapter, she probably brought kris because of their suspiciously absent soul
>>575407565Nice cream wearing the Milhouse fit
>>575407665Jerk off, then I'll figure out what to do
>>575407129can someone stitch this twitter is such an annoying format to read comics on
>>575407659understandable
>pirate gaster>green gaster>sneakers o toole>le vaguepost kingthis fandom can only make dogshit memes now
>>575407659*deer women
>>575407665move on to other stuff i'm not fussed. will miss my wife though
>>575407665make millions of shitty swap AUs
>>575407745who
>>575407875my friends
ralsei sitting on kris' lap while he plays video games... kris yelling slurs whenever he dies...
>>575407565Why did the dessriel class look relatively normal and full of anthro people but Kris' class has actual special ed kids like Snowy and Tem and Jockington
>>575407565shit, this means Dess got lost when she was only 12-13 because of the spelling bee flashback from chapter 2 when Noelle was a little kid
>>575402869Literally anything at all. Anything you make I will save. As you know.
>>575407487Might just be me, but if I had a successful game series I would just keep making different games in the same setting with different spins and different protagonists.There are authors who just make book after book in the same universe and do just fine.Once again, I'm not Toby though.
>>575407565thats just a mom thing to say
ARE WE CONNECTED?
>>575407565dess, pizzapants, nice cream guycatti, asriel, firegirlbratty, mad ghost, the the rando from the dinner
>>575407793Sadly. It's flooded with literal children
>>575407665wdym, encourage AUsthis happened before
>>575407965No nigga
>>575407947Spelling bees begin as early as 8 years old so neither Kris or Noelle could be any younger than that before the incidentBesides wasn't Noelle implied to be 16 today according to the ARG response?
>>575403442hot
>>575407945they fired the sped teacher anon what do you thinktem is pretty smart anyways
>>575407793i like the pirate oneCHIPS AHOY LANDFAGGOTS
>>575407945don't be mean to jockington
https://www.youtube.com/watch?v=8LzgnF4MYqMChapter 6 leak
>>575407665probably play ten million other rpgmaker-esque games. Its a little oversaturated if you know where to lookeven fucking Drawn to Life hits on similar notes and thats a DS game
>Kris diesHow would you feel?
>>575407129There is a world where Kris didn't ditch Noelle after Dess died for whatever sperg reasons they had and Noelle notices them changing and is worried rather than stoked. Kris is so fucking weird, man
why did jockington speak like he had 3 iq in chapter 4 then went back to normal in ch5
>>575407665Make an AU where my theories are true if they're wrongMake AUs about other things if my theories are rightWait for Nutdealer
>>575408176HE HAD IT COMING
so did noelle and kris actually go somewhere or did they just kill themselves and we're going to get out vessel in side b
>>575407793what abour 6 foot 7 the tung tung man
>>575408176very happy#RIPBOZO
>>575408092Tem is somehow lagging behind Kris in the class grades despite studying
>>575408231They went somewhere. If Kris died it would go to the game over screen
>>575408071this is still fucked up that Dess wasnt even a teenager when she got lost
>>575407793I think it depends, 90% of Deltarune jokes have always been bad it's only a handful of jokes that people remember fondlyLike do you still remember that thanos car edit after ch1?
>>575407950even the non utdr ones?
pedophiles > babyfurs
preparing for ch7 so i can make an au where dess pedophile grooms kris on amino
>>575408231The vessel won't be in the weird route
gleep > glorp
>>575408176it’d be funny if kris dies in chapter 6 and we get to play as the vessel for the rest of the game
>>575408157>Drawn to Lifedon't remind me dude I was like 11https://youtu.be/IYujZC7Q874?si=x-ub4PkRQxzHgaSy
>>575408176If it is at the end of some kino masterplan to save everyone that we don't know about I will clapif not then like what are we doing here dude give me the steering wheel next time>>575408231How does anyone see Noelle's face go from under water to dry and go yup. Dead.
>>575408381Kill yourself. You genuinely need to kill yourself.
>>575408375Why not
>>575407623It's kind of hard for Amalgam knight to be real, because the Knight clearly has a personality and intelligent thought, and it fucking sucks at it's job. Like, how do explain the Knight showing up late the Dark Fountain, TWICE, if it's a mindless amalgam in a state of constant pain and confusion Who ever the knight is, they're an over confident bellend who's also extremely manipulative towards Kris
>>575408358Most people here already started doing this instead of waiting for chapter 7
>>575408265there are different types of intelligence anon, tem is an entreprenuer
>>575407665Ill just play every smt game again, im already replaying strange journey right now
>>575408501LOL
>>575408176>One day, your mom's gonna get sick of you, you little freak. And as soon as that happens... Someone might make you disappear. And she'll finally realize how happy she was without you.
damn
>>575406101>Did you see it?friend inside Noelle
>>575408457>How does anyone see Noelle's face go from under water to dry and go yup. Dead.it's an indie game, i don't know how big their pudget for sprites is
>>575408501Early enough
>>575408348You caught me, to be fair. Although the twitter I still have saved :3c And even if I'm not familiar with other medias they are still good..!
>>575408504well i cant draw so i cant make mine yet
>>575408632he he just like me
>>575408471Thrash Machine is a vessel parallel. It gets discarded in chapter 1, brought back under the control of a villain, and then you finally get to use it yourself. But on the weird route, you skip the Thrash Machine's return entirely, and the same will be true for the vessel.
>>575408501>Hi, I'm Fetusry, you're unborn son!
>>575407665then i just marry one of you and make you dress like fave irl so i can always live out the deltarune fantasies
>>575407186The prophecy does intend for a human and a monster, so maybe Dess could only bring Kris along. Susie and Dess also get a lot of parallels, so maybe it was their own thing, but then Dess decided to bring Asriel along.
>>575408638Where there’s one…
>>575408501>Protestors with Lighter at conception signs
>>575408465lol keep malding glorper
>>575407129Goomy is the best
>>575408690I will fuck you rn if you are built like that
>>575408632How the FUCK do any of you fuckers work on a fucking iPad.No fucking buttons. The UI is entirely stripped down for braindead phone users. The screen is tiny as hell.
>>575408351yeah ok Donald
>>575408646There're unused sprites of her literally just sinking deeper into the water. They avoided those specifically so people don't think she just died and people still think she just died
>>575408758The monster bit is never specified in the prophecy, that's part of Ralsei's edits to keep the true prophecy a secret
>>575408838you guys liked it last time so I don't doubt it
Children born of one emotionOur devotion's deepest oceanNo divisionReasoned we'll be free
THEORY: The bunker is a dark world, it's connected to the same fountain in Castle Town.The bunker is a network of tunnels under hometown and the closet in the school is above one of those tunnels, which is why when you first enter that dark world you slide down a cliff-face.
>>575408758in the end though she wouldve been close with kris to the point where shes like their hero and then basically pressured them into doing some fucked up stuff which traumatized them, if dess is the knight theyre still attached to her all these years laterthats 100% grooming
>>575408907My iPad is 11inches, and Procreate is designed to be pretty intuitive. >>575406101 here.
>>575408351Yeah in a fight the pedophiles would obviously win against the babies. I don't see how anyone would think otherwise unless we're talking about Titan Spawns.
>>575409052zero braincells
>>575408907Drawing in real life is just your utensil and your paper, it doesn’t need to be any more complicated than that
deltarune fucking scuks
i think i've gotten about 5% better at drawing than i was last year
I am owed sex
>>575408948What exactly does changing Girl to Monster change in practice Ralsei had to hide that part of the prophecy
>>575409238i'll give you what you're owed. come here baby
>>575408351I would punch a baby for 20.. 25 dollarstheyre not gonna remember it
>>575397861It's a bit
>>575409238come over
Chapter 6
>>575407623Adding onto what the other anon said, based on what little we've seen of the Knight's personality so far, its main traits aside from aurafarming are being impulsive and reckless especially when its ego is threatened. It summoned a Titan just to spite Susie for trash talking it, and it sped up when Flowery taunted it while missing that there was a wall right in front of it, which it immediately smashed into like an idiot. This isn't really consistent with Kris or Noelle's personalities.
>>575409337the dead tell no tales
according to my calculations it would appear tennafags lost massively
Lately I’ve felt really drained later in the day, and it sucks because it’s been taking away from Deltarune stuff. Since I do Deltarune stuff later in the day. Maybe it’s because of doing a lot of yard work lately or changing my medicine dose.Still wish I lived in Hometown.
>>575409449false
trying to imagine the headspace of someone who doesnt want to be bullied and brutally fucked by fave. a loving relationship? thats what you fantasize about? just a normal one? the fuck
>>575409017Let's assume that's correct. What does this theory now imply to the rest of the story?I can only see this meaningA) Sealing the Shelter fountain seals castle town.OrB) Castletown has to be cut off from the Shelter before sealing it. I mean, there's a fair chance you're correct, but to be honest it doesn't seem like anything changes either way.
>>575409029>then basically pressured them into doing some fucked up stuffIf they were playing along with the prophecy, I doubt Dess would have to pressure them into it. Kris clearly has fun in the dark worlds with Susie 99% of the time, adventures are fun.
>>575409128Sure. Drawing isn't terribly complicated, butmaking anything more than, primarily painting, that requires knowing what type of materials you are using.
>>575409635You can do that on iPad what do you mean
>>575409531my calculations are done with the utmost perfection. i am never wrong.do not even try to imply otherwise.
>>575409289i dunno, but that doesnt change the fact its never mentioned in the actual prophecy. Ralsei says "Human, Monster, Prince from the Dark" and the prophecy says "Cage with Human soul and parts, the Girl, and the Prince alone in deepest dark"I guess maybe its because Susie wouldnt readily consider herself as "The Girl" whereas "Monster" is a lot more fitting because she's trying to be rude and tough? Like the girl implies someone who will wear ribbons when told to.
>>575409579Why are Rudy and Asgore so gay
>>575409613>Sealing the Shelter fountain seals castle town.I think it's implied Castle Town will have to end and the final fountain will need to be sealed.The ending of Chapter 5 shows that Susie is falling deeper into the fantasy/escapism of the dark worlds which as Ralsei himself said are not real.
>>575409680tennaGODS literally cannot stop winning even if they wanted to
>>575409613It means we can skip getting the last two shelter codes and just enter the shelter from Castle Town
>>575409679I never said you couldn't.I just find doing so really fucking annoying.
>The last Shadow Crystal was in chapter 5>The last Starwalker was in Chapter 5>The last Moss was in Chapter 5>The last Egg was in Chapter 5>The author never finished the 6th book >Weird route completely skips chapter 6Chapter 6 is not going to be a normal dark world adventure. The secret boss will probably be Seam, and you fight him in the Castle town segment. With how things are being set up, I expect the chapter 6 dark fountain is going to be the Holliday home, and we're going to get the New Home style exposition dump on all the Holliday family members and what their deal is, including the Knight reveal. And then we get the REAL story, not the sanitized Chapter 6 version, in the Bunker, which is the True Lab equivalent Gaster stuff happens in the Weird route because you glitched in to Man Country
>>575409463Hope you get your energy back soon, anon. One day we'll all live in Hometown.
Spell ideas>WATER MAGIC>Waterspout - causes all foes to be DRENCHED>Geyserburst - deals decent WATER-elemental damage to all foes. Depends on Magic.>BriskTorrent - A sudden torrent targets a single foe, dealing WATER-elemental damage three times in a row. Depends on Magic.>VitalDrain - deals minor WATER-elemental damage to all foes. all damage is returned as health and spread between party members>DancingDrops Water-type spell. Deals MUSIC-elemental damage to a foe. Depends on Magic.>Miracle Fountain - Magical healing water surrounds your party. for the next 5 turns everyone heals 8% HP each turn
>>575409703The freaking rang the bell at the 'Festival Gay Couple Power Level Hammer Game.'Their pairing is at least lvl 47 gay.
>>575409893Kris would still be Catti's friend if she wasn't a cowardly backstabbing BITCH who left them behind...
>>575409767Ive been saying forever now, there's a good chance the story will end with Susie choosing to stay behind in Castle Town as it gets sealed. It just makes sense, she's grown too attached to accept being apart from it and it could be a lasting consequence of Kris' betrayal
I am Carol Deltarune I lost both my children (two)
>>575410063Ay baby you wanna make it three?
>>575410059how would she be able to stay behind she’d just end up in the light world
>>575408768Oh, found a second one!
>>575410063It's over, the Holiday bloodline has fallen...
Rank the secret bosses by FUN
>>575410202Nice! I will say there’s only two so as not to waste your time lol.
>>575410254Spamton NEO WR > Gerson > Roaring Knight > Jevil > Pink > ERAM > Spamton NEO normal
The Castle Town fountain will remain unsealed indefinitely as it is needed for the all-important postgame where you can play all the minigames forever and you have to login daily to pet Ralsei so he doesn't kill himself
>>575410063>cut to me fucking SAVING the SHIT out of Hometown and everyone including Dess and Noelle>cut to me fucking DODGING the FUCK out of FRIEND attacks>cut to me fucking BANISHING the SHIT out of the Titans>cut to me fucking EARNING the best ending because I am CRACKED
>>575410196>Susie's Idea
>>575410059There is no staying behind. If it gets sealed it's over, so she'll try to stop it. She'll be King again they literally show you her with a crown this is good because chaos king is a top 5 theme
>>575410196She just jumps straight into the fountain and becomes a darkner. That's what happens to the Susie plush in chapter 5 after all, it gets tossed into the darkness and gets to float aimlessly with Ralsei forever
>>575410441You can do all of that and that still wouldn't unmolest Kris, Carol.
>>575410471Oh no its the Rouxls Kaard CONTROLE CROWNE!!!! Susie nooooo!!! Take off the Crowne nowwwww!!! Nooooo!!!!
>>575410510i’d rather just have ralsei become a lightner that’s kinda bleak
>>575410598It's okay, Susie isn't disc-shaped
>>575410598you joke but there is no world where she just lets us old yeller lancer
>>575410510Gloomy but a cautionary tale. I think that falls too much into escapism bad territory
https://youtu.be/xYScugBAWQ4?si=ZsX159VzzhP-hLH8i know im not the first to say it but this very obviously gasters theme remixed. He's probably gooning to the player's fuckups
just read a deltarune comicthats crazy
>>575407947>>575408071This has me thinking about how odd Dess's time of disappearance really was. She simultaneously disappeared when Kris and Noelle were still quite young but at the same time her and Asriel were old enough to be "practicing" together. If this wasn't a Toby forgor situation this could be intentional as the entire nature of Hometown within the game itself is off. They suddenly got cut off at the start of the game and Dess "left" at a young age but they also have memories of her being around as an older teen. It's as if Gaster made a late decision to remove her from the simulation specifically for some reason, hastily retconned the dreemurr and holidays' past but forgot to change Pizzapants's memories for whatever reason.
>>575410795More like Noelle's monologue is the exact same shit Gaster was thinking before doing all that. Noelle's not a mad scientist though so she needs us to brute force it
>>575410515I can molest you.
why do people like friskliteral non-character
* The Castle Town... we can't give that up, right?* Not... for anything.
Holidays are full of SurprisesNoelle: Bubbly girl next door who's a bit more lonely then she lets on -> actually a TWISTED and SICK psychopath with SUICIDAL TENDENCIES and a DEATH WISH who enjoys MURDER and TORTURE and thinks her hometown SUCKS and is filled with STUPID peopleCarol: Heartless and frosty Ice Queen who rules over her town and family with an iron fist -> Actually a very compassionate person who wants the best for everybody, and just accepts the role of villain because it's easier that wayRudy: Cool Dad who's tragically terminally sick and just wants his family to be happy -> the EVIL Roaring Knight who has orchestrated everything from the start, a fundamentally dishonest and manipulative man who is sacrificing everything including his Daughters happiness and sanity for his TWISTED planDess -> Cool Punk big sister who's sticking it to the man and rebelling against her overbearing mother -> Pedophile
>>575410937It's plausible if she was 15 and Noelle and Kris were 10
>>575410950>>575410795Suicidal Gaster is a new one
>>575410937toby has a great excuse to pull off the "compltely different education system in hometown" because age is getting perceived there differently
>>575410975NTA but can you molest me while you are dressed as Aqua?
>>575409625>she was enjoying it officer
>>575411543>>575411543>>575411543egg
>>575411120It's why I'm optimistic for weird route. She's the stand in for him. Maybe we can get her a better outcome than being shattered
>>575408501fetus ralsei theory is unbeatable
>>575406324yah that's a good idea anon, definitely the same vibes since kris would still be like enjoying the adventures somewhat probably but still probably be like scared and everythin else
>>575401245H-hot, maybe if Royal Guards were more like this in-game they would be more popular
