Previous thread: >>484047421Season 4 - Clear All Cathy2024.03.28 —Mirror Dungeon #4 - Mirror of the Wuthering2024.05.02 —>Upcoming EventsRefraction Railway Line 4 - Masquerade2024.07.04 —>Current EventsRefraction Railway Line 3 - MirrorClock OrangeRoad2024.02.01 — 2024.07.04Chapter 6.5 - Timekilling Time2024.06.13 — 2024.07.11>Upcoming Extractions>Current Extractions2024.06.27 — 2024.07.11[000] T Corp. Class 3 Collection Staff Don Quixote[00] T Corp. Class 2 Collection Staff Rodion2024.06.27 — 2024.07.11Target Extraction: [ Yi Sang ] ID & E.G.O>FAQs! This game is directly tied to the setting of Project Moon's previous games, Lobotomy Corporation and Library of Ruina, and is set after both. Expect spoilers for those games in this thread.! The tutorial is important.>Download linksAppStore: https://apps.apple.com/app/limbus-company/id6444112366Google Play: https://play.google.com/store/apps/details?id=com.ProjectMoon.LimbusCompanySteam: https://store.steampowered.com/app/1973530/Limbus_Company/>Other linksOfficial twitter: https://twitter.com/limbuscompany_bOfficial youtube: https://www.youtube.com/@ProjectMoonOfficialOfficial site: https://limbuscompany.global>Required readinghttps://mega.nz/folder/xosDkZ5Z#Wt4JpUt5Bb2XG77pxuuXpw>For all your EGO and Sinner info needshttps://limbus.kusoge.xyz/https://gll-fun.com/en/>Useful resources and a general guidehttps://rentry.org/lcg_resourceshttps://rentry.org/lcbguidehttps://rentry.org/LCB_optimal_grind_guide>Countdownhttps://lcbcountdown.carrd.co/
Sinclair?
Charon.
Who is demian’s rose?Is it Lisa?I wanna know how much he cares about her still, because they were very close in the cutscenes we saw.
who's that snail!
Sinclair is cute! I want to give him lots of kisses while I rape him!
Uptie 5 will never be real all my garbage units will be garbage forever
>>484113881God I wish I was Ayin so I could watch.
Rodya LOVE!
Thoughts on Netzach x Hod?
Faggots ITT.
*cough*
>>484114249None.
>>484114249Cute but I prefer other obscure Hod ships I think about
>>484114279Mauft? Fause?
You know what? Have a bad sunday. You take this post's last 2 digits as SP damage.
Wife.
GIVE ME WOLF HEATHCLIFF NOWNOWNOWNOWNOWNOW
>>484114676Wouldn't that overflow back into 31 SP? Considering life just gave me yet another bullshit unfortunate event, that's pretty good.
>>484114765You get next week teaser and you will be happy about it.
>>484114676I had a bad Sunday. If it was a good Sunday it wouldn't have ended!
post favorite artistsfor me it's chocolateplushy
>>484115062Brother, it is Sunday right now. It's 12:12 in human time.
>>484114765Didn't the last few "bad end" IDs drop a week into the railway? Good chance it's going to be like that this time too.
>>484115226It's 12:12am
>>484114696Guido...
>>484113338
What is her face supposed to convey?
>>484114765>Gif
>>484115548Pure desire
>>484115332No, it's 12:16pm, dumbass.
>>484115548Plans for molesting shotas.
>>484115714
>>484115332filip*no anon...
>>484115901
>>484116115
I'd rather post lewd Ishis instead of cool Ishis
>>484116326
>>484116547
>>484116527i demand the saucepls
Suddenly there is the stench of rotten fish in the air.
>>484116773
The distinct smell of a rickety boatbilly...
>>484114676Countering with the last two digits of my post
Am I tripping or do T Corp IDs never get staggered when their Borrowed Time ends?
>>484117131
i just had 3 consecutive hefty farts and i am definitely smelling something alright
What's with all the Ishmael spam?
>>484117378
>>484117503Dead gamePosting fanart is the only thing worth doing and maybe shipping discussion
>>484117591>shipping discussionWhat I would give for another round. Sucks that I lost my 4gb of folders
>>484117347You need to hit them with a bunch of bind before it expires. T don doesn't stagger either when it just runs out.
>>484117578
>>484116963https://x.com/ubsd18
>>484117591>Posting fanart is the only thing worth doing and maybe shipping discussionPosts like these reminds me of the gap between /v/ and /vg/ since I saw a great thread there yesterday where some guys were beefing and had an hour long discussion over the storytelling of Ruina and Lobotmy + Limbus, then it switched to abnormalities and before that it was like 300 replies of discussing the railway.
>>484117934thanks pal>>484117475https://www.pixiv.net/en/artworks/119293393
Did someone say shipping discussion?
>>484117807
Question for draw frensHow often do you draw suggestive stuff but don’t post it anywhere. Like just stuff for yourself?
>>484118035
>>484118017Flustered Outis makes my male instincts activate. I HAVE to press this woman into my chest and plant kisses on her neck.
>>484118017This isn't even a ship. This is just a greek and the twink she's fucking on the side. It's a historical thing.
>>484118249
>>484118154Only sketches I don't plan to complete or don't feel like sharing to the world.
>>484117475
>>484118154I draw sinclair's dick to myself every day.
>>484118017>master1200
>>484118454
>>484117976All things happen when its due time for them. This thread also is great sometimes
>>484118578He just decide to go full master
>>484118017Flustered Outis makes my male instincts activate. I HAVE to press this woman's face into my dick and plant my semen in her mouth.
>>484117976>Posts like these reminds me of the gap between /v/ and /vg/There is none. But that doesn't keep both sides from coping that they're somehow different from the other.
>>484118493>>484118519I think when I have no ideas I shall start doing the same with Hod’s sweaty boobs when I’m not tiredThank you for the responses
>>484118680
>>484118454Ishmael is such a flower. Goddamn I need to find me a red head. Why are green eyes so rare? Such a lovely combination.
Is there a script or browser plug in or something that makes BilliBilli not cancerous and allows me to watch a video without constant interruptions?
>>484117976There was also a discussion about Michelle’s age lolNot that it was bad, but it’s nice to see people talk about the sephirah still
>>484118908
>>484119114
>>484119324
>>484119562
>>484118017Flustered Sinclair makes my fatherly instincts activate. I HAVE to pull this young man's face into a dadly hug and ruffle his hair
>>484119796
This thread's getting worse and worse
>>484120092
>>484120057
>>484120303
lmao could not be happier that Ishmael's character was reduced to >"muh blind obsession"
>>484120578I’m disappointedShe’s the one sinner I felt attracted to design wise (the hair mainly)So her character development ended up disappoint me greatly
>>484120556
>>484118017Flustered Sinclair makes my female instincts activate. I HAVE to pull this boy's dick into my face and plant his semen in my mouth.
>>484120578Is this the same as saying Rodya's character was reduced to a foodie?
>spammingI'm leaving.>inb4 see you laterLol. Lmao even. Maybe in 3 months.
>>484120914I’m coming with you, my prince
>>484120914see you on 9/30
>>484120787
>>484120996nice
>>484121027
>>484121264
is this the best /lcg/ thread that ever existed?
>>484121492
>>484121739
>>484121618Not even close
The best /lcg/ thread was the MMO thread. Nothing will ever top it.
>>484121957
Love me wife Outis!
>>484122180
>>484122415
>>484122681
>>484122180Where does the anchor come from? Pink shoes has nothing to do with the sea, and ishmael's weapons are maces and her ego is a harpoon.
>>484122876
>>484122962you should probably look up what an anchor does
>>484123103
>>484121618>>484122068The best one was the breast milk discussionThe breast one, if you will
gigabased ish doomper
>>484120578>"muh blind obsession"Because she's cognizant of the drive that was steering her life. She lost Queequeg and the other Pequod survivors but made her peace (so far) with the doomed voyage and came out a better person for it.God forbid a character has a theme, like Heathcliff's revenge now being steered towards remembering and trying to reunite with Cathy.
>>484123340
>>484122962Pierce damage. And re-using harpoon for blunt/pierce and slash themed EGO Ish gets would be very stupid.
>>484123349shut the fuck up, carlos
>>484123579
>>484123807
Shut the fuck up you murder homos
>>484124049
>>484124268
Please post Heathmael.... I've been thirsty
>>484120864>sexo Ish>but size differenceOh well, I'll just ignore the giantess stuff and coom to Ish later today anyway
>>484124507
>>484124748
So we're just posting boatbilly lewds now huh? That what we've been reduced to? How the mighty has fallen
reposting cause I posted this one when the last thread was on its last legs, you can go ahead and call me a faggot
>>484124985
>>484125218
>floor 5 Hurtily>>with a poise teamOh my fucking godddddddddddddddddddddd
>>484124996That's useful. Thanks a lot, anon.
>>484124987What's wrong with posting sexy pics of the hottest sinnerCoomposting is what every gacha general does anyway
>>484125463You CHOSE to pick Hurtily!The fault lies with YOU!
>>484125438
>>484125463You chose the pack
>>484125652Need this Ishmael to break my pelvis
Can i get some fairy ishmael with faelantern sinclair please?
>>484125650>>484125696I WANTED TO FACE AHAB REEEEEEEEEEEEEEEEEEEEE
>>484125463How does poise team make it worse even
>>484125652
Post Ishmale
>>484125813Final boss hurtily has very jacked stats, notably is that by the time you make it to hurtily in hard, he likely has a couple thousand health, with very high defense levelsNeed i remind you of it's revival gimmick?
>>484125772
>>484120873No, because that one is not true.Last intervallo repeated that notion, so that even the most illiterate understands it now.
>>484125872
>>484125772lunch
>>484125973
>>484125813I imagine most statuses can apply so much that you can kill Hurtily every turnCharge and Poise however... and wholly reliant on their own dmg without applying debuffsIt's a slog vs Hurtily on floor 5 who is stupidly jacked
>>484126095
>>484125979So just because high defence? Eh
Are status teams good outside of MD too? Story, RRs and dungeon events. Because it's hard to justify a status team over a bunch of high rolling nukers that work on any content.
>>484125534>Hottest sinner>Ishmael
>>484126307what >>484126194 saidpoise suffers the most against hurtily due to the revival gimmick and jacked defense level, any other status team however can meme on em
>>484126283
>>484126326Canto 6 was pretty clearly tuned around you bringing a Sinking team and it eliminates a lot of the early-round "please god just roll one head and win the fucking clash" nonsense. TKT meanwhile is obvious tremor shilling. Heck, I'd argue that story content in general is beginning to tighten up and not be AS weak to slop, even if it is still weak to it.
>>484126474
>>484126326>poisegood >sinkingvery good>tremorgood>chargevery good>rupturevery good against bosses shit everywhere else>burnI dont actually know but their ids are good now so probably pretty good
>>484126801>chargenot a real archetype.
>>484125772I could've sworn I had another picture of them together but I can't find it.
>>484126326Burn is kinda meme, but faster clears in normal fights.Sinking is good and you have deluge, also rime shank attack power down but it's hard to maintain. Requires a lot of investment to work.Rupture is just hard to maintain without talismans, but it will eat through bosses Bleed is better burn. No idea about Tremor. Just like sinking. You just need reverb and what not.
did bamboo hatted kim get any fanart during the BL intervallo? All Ive seen is stuff for BL meur
so which future public domain character do you want to see turned into an abno?
>>484125796Understandable>pick floor 5 Pride pack since it can 50/50 into Gasharpoon for a kino finale to a run>instead it's 3,000 HP THE FUCKING STRONG with 3 revives
I hate MD4 so much. Take me back to the Bloody Mist days...
WoahThat's a lotta Ish
>w corp meursault>passive has nothing to do with charge>lowest speed ally inflicts plus one (Uno) (Hana) (Un) (ένας) rupturefor what purpose?
>huge twitter post where outis trannies talk about the beta art>saying how glad they are she isn't that small in the final game because it would be "lolibait"im glad i mostly just interact with 4chan for limbus stuff
>>484127498passive is good on rupture teams howeverR corp meur is the charge bench warmer
>>484127279>>484125463
>>484127527PM Twitter is legitimately one of the most faggot infested group of "people" I've ever seen.>Someone makes a joke about wanting to make Don a mother>PM Twitfag whines about how it wants to gun down everyone who makes the fertility medicine joke
If twitter is so bad why are you fags always there and always bringing their shit here
>>484127736I thought that meme was implying Don was a hag (or has a dead womb)
>>484127805uhhh bro? This place is where you come to say nigger and shitpost (lol)reddit and twitter are where serious discussion happen we all know this
go back to your website twitter trannies
>>484127805Because most posters here are from xitter but come here to bitch and moan about the shit happening there
>>484127805because I need a break from reddit and discord.
>>484127805Because artists REFUSE to use websites that aren't Twitter for some reason
>>484126801>>484126991Qrd on sinking? I have a full team but I didn't run it that much outside of MD. It seems to struggle a bit against bosses with SP, with deluge being the only source of damage. And deluge is a bit janky to use most of the times considering I struggle to keep sinking count.Also any other required UT4s outside of Rodya?
>>484128072sinking count isnt hard to maintain and even if youre a brainlet you can just use rimeshank>Also any other required UT4s outside of Rodya?no
>>484127736you forgot to mention how PM twitter also sees don as "minor coded" and will attack any sexual post with don except for lesbian ships
youre not exempt from being a worthless fucking twitter nigger because you dont agree wit other twitternigsin a just world you would all get shoved into a gas chamber with the rest of the crazies
>>484128279we love children in this neighborhood
>>484127527The western side of this fanbase is so fucked lmao, I bet these bitches didn't even touch Ruina
>>484128279But I saw a Twitter post saying the opposite?
>>484128025Very sexable
>>484127527lolibaba outis...
>>484128532>I bet these bitches didn't even touch Ruinabet? lmaoalot of them admit that they only watched videos like "lobcorp/ruina explained in 10 mins" before just jumping into limbus.atleast back when ruina came out new fans were willing to try lobcorp first
>>484128595i doubt it.same goes with charon and how she started a big drama that resulted in her art being purged from rule34
why does PM hate slash?we havent ran into slash weak enemies since the BL mini
>>484129208good, she's meant to be loved, not lechered.
>>484129334Your Linton Family Butlers? Your Ring researchers? Nelly?
>>484128425
>try to draw a brain>it looks like lunacywaw!
>>484129793charon is built for cute wholesome plaps and getting impregnated
Bros, Sinclair keeps getting only 3rd even when I slot him first... I thought he was supposed to be good?
>>484130556>he fell for the philipclair meme
>>484130556you do have base yi sang and hong lu on bench right?
>>484130743You can literally see Hong Lu there, and yeah of course I have Yi Sang. However most of the time Yi Sang and Hong Lu Passives are stolen by Ryoshu since spamming 4th Match Flame is the fastest way to clear stuff, especially when you accidentally get the Gem instead of Glimpse of Flames
>>484131048>sets his 'lip up to fail by having GREEDshu hog the passives>why is my 'lip shit?
Sinclair is shit in general, not really that surprising. Even nclair is slightly better than average at best now. Won't stop /lcg/ from drooling over him, though.
cathy fags your respons?
>>484131536>Sinclair is shit in generalfalse>Won't stop /lcg/ from drooling over him, thoughtrue
>>484128025Tummy should be slightly chubbier me thinks
>>484131157if you need center what your team is doing (and 1/3 of bench passives) around one id or it will underperform its might not be a great id, food for thought
>>484132128Limbus Company?
I passed the daily penis inspection bros. It was close today, glad I made it.
>>484131612She has a child with her husband in the book bro... She probably won't mind.
>>484132183Yes.
>>484131536>Even nclair is slightly better than average at best nowI wish same could say the same about more IDs in general.>Won't stop /lcg/ from drooling over him, thoughWould cover him in my semen. But ID perfomance has nothing to do with that.
how many tickets to get from level 40 to level 45?
>>484132183Limbus Cumpany
No woman in Limbus company is a virgin as every one of them is above the age of 12
>>484131157By that logic, for Philipclair to be good you need to:1). Have two specific support passives, (or 3 if you want whispers)2). Be able to fuel said support passives (he has a gloom skill 1 but needs 4 gloom to activate Yi Sang, and literally only Liu Mersault has any real sloth generation, of which you need FIVE for Hong Lu Passive)3). Never use EGO or else they will steal his passives (Burn has literally the best EGO lineup of any status. Imagine NOT using shit like 4th Match Flame)Hmm... Sounds like a shit ID?
>>484132792Its true, i made sure of that
Detective love...
>>484132792wrong, Faust was recently created.
>>484133524thats just meursault and hermann
>>48413265735k or something.
>>484132792are you implying that Dante (me) wouldn't fuck a 12 year old?
>>484132183Arr gachas rook same
>>484133524Do we trust him to make the promised DD game in the future?
>>484134275I'll never stop believing!
What are the best benches for a sinking team? Outside of the core team and Faust the rest of the sinners are utterly lacking any sinking option.
>>484133524I haven't read DD but seen a ton of fan art.What is their character?You can extract from art of any sinner or Sephira roughly what their deal is.Those two on the other hand are just depict as standing around without any form of characterisation.
>NIGGER!>I'm so, it's just NIGGER>I have a condition and, you know NIGGER>I blurt out the word sometimes, it's out of control>I'm not racist, I love all NIGGERS, *ahem* you know people of my race- I mean all races>I just have ticsSinners for this feel?
>>484134959Faust
>>484133205>1You only need two. Whispers and Yi Sang/Hong>2This is how you pick support passives in a first place. So yeah. >3>using EGOsLmao.>shit IDYes. Worth using it because easy AOE and S3 big damage.
>>484132498>can't sit next to RyoshuIt's over
Otherstatus-sisters? What is out response?
Your destruction is at hand
>>484132498Seat number 4 is probably the best so long as you don't mind Outis mumbling about everyone else being useless shitbags, and Kroomer krooming herself over Sinclair being only a row away from her
>>4841324987 looked good until I realized 8 is a timed bombWhat the fuck are Yuri and Kromer doing thereOh my god this was made by a yuri fag.
>>484135310>Not using EGOsLiterally why wouldn't you use insane nukes like 4mf and Abs when you have them and automatically complete their conditionals? Hell, you could probably use Forest for the Flames EVERY turn in burn, given how common lust and wrath are
>>484132498I can't sit next to Sinclair
>>484135501>Sinking deluge is the first skill this turnDon is a fucking gypsy in this id that steals all damage
>>484135697What about 2?
>>484134887Moses is very calm and composed and Vespa is professional and reserved, but also hates anything related to the thumb.
What type of bras would the sephirot wear?I need to know for drawing purposes
>>4841324981 or 6 are the obvious choices for frequent fliers. Keep in mind you have to worry about who's sitting in front of and behind you as well.
>>484132498Seat 2 is ideal. You get chill Greg to chat with. Rodion will get bored and grab and talk to you from behind because Dante and Vergil are boring. And you can even smell Ryoshu's hair from behind. IDEAL.
>>484135995animation slowgabba go fas
>>484137467If it's twice as slow but attacks 3 enemies, then it's still faster
>>484136082Okay I thought about it, and I can take 7 and try to trade seats with Ishmael. The window seat is generally considered to be better than the middle seat, so I think there's a good chance she'll agree to swap places
>>484137336>6Kill yourself demian. Fucking delete yourself you retard. Right now.
>>484132498Seat number six.
>>484137336>1 or 6 are the obvious choicesIn 1 you get constant smoke blown in your direction.At least with 2 Gregor would stop if you ask him to.6 would mean Don's constant screeching, robbing you any opportunity to take a nap.
>>484137635acquire the glimpse, go the fast
>>484137874You can't smoke a plane
>>484138072Ryoshu obviously would not care
Dear Guest: I formally invite you to the library.The Library's books can provide you with all the wisdom, wealth, honor, and power you seek.However, an ordeal will await you in the library.If you cannot overcome this ordeal, you will be converted into a book yourself.
>>484138243Charon would be forced to smell it and thus Vergilius would force Ryoshu to stop.
>>484138284I hate to break it to you, but that imagery of an infinite/spatially impossible Japanese castle is older than Ruina.
>>4841324984 easy
>>484134241Limbus would sell so much more if it had designs like Ilsa.
>>484134241>>484139370limbus would make a gorillian dollars every month if they stopped being prudes and gave us more exposed armpits
>>484138670Are you telling me el Director didn't come up with The City all on his own? That's preposterous
>>484139717There has never been a good post with this image
>>4841324981 4 2 7 is ok3 is bad but prob ok if make effort to not exist8 5 is bad im likely dead
>>484139919No, but he did steal imagery and ideas he liked and find creatively distinct ways to use them, which is based.
>>484139950>he says when the quoted post was very high quality
>>484139919The same way none of your thoughts are original cus they only happen beacuse you experienced other things. Its impossible to come up with something when everything you know is based on something else
I forgot again but what was the reason why Kromer doesn't have a sanity system? Was it just because it was earlier Limbus and PM didn't knew how to make human battles with the abnormality fight format (The one you can choose were to attack) back then?
>>484140985she was already insane
>>484140985I think PM just didnt bother but i also think it fits really well for her
>>484140985they couldnt figure out how to give 1st phase kromer sanity and 2nd phase kromer no sanity back then
>>484140985I'm certain they coded that battle as an abnormality battle because that was the only way to make non-focused battles back then. I also believe that's why she had a threat level too
Still hilarious how people announced what a failure Carmen is and how we wipe all of her distortions away, only to realise our company is selling artifacts that artificially distort people.
>>484141728It's called progress, okay?
>>484141728DOESN'T COUNT
>>484141728anon who do you think sells the distortion-go-away solutionit's literally free money why would the lumbis cockpanties do it
>>484142116Wheren't we competing with some other group to deal with distortions?
>>484141728Carmen has been a failure since day 1.
>>484142116>it's le get-rich-quick scheme by genius PAUS xDDDCome onIt's obvious they're doing it to try and harness the potential of distortions tooHubert's dialogue should be enough to signal this
>>484142605you say it as if Ayin had any success
Should I spend my shards on new Don?
>>484142956If you are willing to make a tremor teamOtherwise, no
>>484142956do you have all the stuff for a tremor team? Then yesif not then no
>>484142926The head lost.
>>484143531Ayins "success" is where people like Dongrang and Ahab still have leading roles so not that much will change without another person to give it another push
koreans are going to doompost tomorrow, already spamming steam stats about the game
>>484143737so free lunacy? Nice
Guys I think vtumor brainrot has grown on meI've noticed my youtube content for the last month or so switched almost exclusively to cute vtubers doing cute things while I sit therew grinning like a retardHow do I fix myself? Can I even fix myself at this point? What awaits me?
were big boobs part of Fausts deal?
>>484144240You will either accept this and become a vchuuba nerd or it will pass like any other thing you get bored of. Enjoy it while it lasts and hope it will last long so you can enjoy it further
>>484144248Should’ve paid for a big fat belly tooHmph!
>>484134959
any file sharing site that doesn't need a account?
>>484144902yeah there are tons
>>484144902nah they all just get shut down
>>484144902maybe, it depends on content
>>484132498ill take 7
>>484145121just jpgs if it can also handle small webms it would be great but i can live without it.
>>484145262I can't think of any sites like that, sorry Anon
>>484145262>>484144902holy fucking newfaglurk for like 3 hours before posting tourist
I've seen Heathcliff being shipped with almost every sinner, both male and femaleWhy does the community love gypsies so much?
Happi Happi Charon.
>>484145538He is cool :)
>>484145538heath is best boy, and best girl
>>484145472here is your (You) fag
>>484145745>Femcliff
>>484132498>All these responses>Only 1 (uno) person talking about seat 2It's the literal best seat. Chat it up with Gregor, chat it up with Rodion, or simply chill because they (Gregor at the very least) would let you be if you wanted toThe only other best option seat would be 1
>>484143737What happened??
>>484145745>has more genderbend art than both Hong Lu and Yi Sang combined
>>484145538He is made for shipping.
>>484131962I only use Yi Sang passive and he's never not been max damage. I.O.S.
>12 hours remainingAlright, name the fights and we'll see who gets it right
There is a lack of good looking Alfonso pictures right now
hello anons, it's me, dante aka your manager. Anyways I just want to let you know that I gave Rodion a ham sandwich and she gave me the most insane head of my life. Shit was cash moneyanyways that's all my shuckers catch ya next week
>>484146317Why would Sinclair pretend to be dante?
>>484145931>It's the literal best seat.Yes, because it's the only window on the 2-seat side.Who cares about the sinners I'm boarding piss drunk and will black out as soon as the plane starts ascent.
I'll be stuck in surgery for 10-15 hours tomorrow for hair transplantThat's all I wanted to say
>>4841324981I can sleep in peace.
>>484146317I don't think Rodya would suck anythingMaybe pin you down and lay over you or something but she's not down with getting down on dick head first
<That is not me. I didn't give Rodya a ham sandwich, nor did I get my [CLOCK] sucked.>
>>484146505ganbatte anon hopefully they put right hair in the right place
>>484145538Here's a little tip for you: There's at least 1 person that ships any sinner ship.Any.
>>484132498Seat three.The sinners will keep their general retardation away from me because I am adjacent to Vergilius and he will also likely mind his own business as long as he isn't given a reason to get up. Dante also cannot likely cause problems given Faust is too far away and her soft tones will be impossible to convey through the Don Quixote sound barrier. Rodion may chat me up, but this is acceptable. The only problems I foresee are this:1) It is unlikely I will be able to sleep. I do not like the sound of clocks. But I'm terrible at sleeping anywhere other than my bed anyway.2) Charon may get bored and ask me to switch seats to sit next to Verg. I will have no choice but to comply should this occur.
>>484132498Any reason why I can't sit next to Ryoshu?
working on a theory that the limbus books are tied to jorge luis borges in some way. he states he was influenced by kafka, dostoevsky, and goethe, and the stories the garden of forking paths and pierre menard reference dream of the red chamber and don quixote respectively
>>484145538He has a short fuse, but he is unironically the most NORMAL of the sinnersNo, I'm not shitposting>Yi SangGenius inventor, pun speaker, recovering from depression(?) >FaustFaust>Don QuixoteSchizophrenic, encyclopedia of all things fixer>RyoshuMurderhobo supreme, seems to have been the strongest of the sinners before they shackled themselves to Dante. Has the entirety of the Finger syndicates after her, supposedly>MeursaultStupidly composed to the point of disbelief, has claimed himself that he is of different composition in full seriousness>Hong LuLiterally possibly not even human to begin with>IshmaelSurvived the Great Lake and a head-on attack form the Pallid Whale as a deckhand of a rickety ship that was falling apart. Wracked with wrath and gloom to her core (prior to the ending of canto 5)>RodyaCommunist(?) Glutton. Gambler. Wants to stand out as someone who is "special">SinclairMark of Cain, murderous gaze, "hidden potential" trope>OutisMarked as someone whose past is hidden under lock and key. Ass kisser for seniority in rank>GregorSmoke war vet, tormented for who knows how long by his own mother. Has probably seen the most shit amongst the sinners, suffering from PTSD. Also a literal cockroach arm with implications of a LOT more further mutationsCompared to all of these... Heathcliff is just a short fused tard with a bat, in love with an adopted sisterBest boy
>>484146116Aside from Gregor and Outis, they all are
Does /lcg/ like Mr Roboto by Styx?
>>484146861Faust x Gregor.
Who is getting her EGO?
https://mega.nz/folder/eXhWCYJL#XTFgooiTls2aufTNDubTpQall aflonsos i made
When do you think season 5 will start? I'm thinking mid August
>>484148078I can't imagine there's not a dead month or two, so I'm guessing October.
>>484147805outis and maybe ryoshu
>>484147805I want to fuck this stupid handless girl so hard she cant walk either
>>484147475>>Hong Lu>Literally possibly not even human to begin withPoor Hongers, misunderstood till the end
>>484147728Frau Faust and Herr Gregor
i love that lots of genderbent depictions of hong lu has her with huge fucking tits
>>484147805Outis RoadFaust ScarecrowRodya WoodsmanDante OzmaI don't know who'd get Courage/Scaredy Cat
>>484134887tired old lady with Vietnam flashbacks tired of everyone's shit and professionally professional seething in quiet anger as he pretends everything is fine while wanting to go apeshit due to accumulated frustration.
>>484145538>Violent ragetard who is actually a kind soft boy on the insideHeath is the PERFECT yumebait
>>484147925nice
Time to do the dailies
Time for your dailies, Limbabs. Don't disappoint today, okay?
Dailies!
The hour of dailies! The time or purification is upon us!Fufufufu...
tyim tyuu dyuu yuur daiwies wimbyabs!!
https://mega.nz/folder/TfgXXJ5B#APRRWDWdJ59nSed4oMrp-Qthe rest of the kots
>Spain won just in time for the dailiesVAMOS
Only the bus driver was on time.
>>484148650>orFaust fucked up again, Faust asks for forgiveness
>>484148341>Big tits in genderbend art = Big dickSorry I don't make the rules
>>484148541>>484148630EARLY>>484148650>>484148687LATE>>484148632On time!
>>484113338https://poal.me/w7eiq7thanks fro voting, its clear now that all of you do not like Carmen's plan at all and would rather die or live a awful life that to distort
Yay I won
>>484148746nyepic
>>484148687Gross.
>>484148226yes, the source book is metaphorical, but project moon tends to take the source to its extremes, so he’s probably literally a space rock
>>484148913
how come our only two minus coin characters are potential man and Nclair?
>>484149397This is really cringe
>>484149513because nclair scared them into making potential man and since potential man was so bad they're afraid to make anymore
>>484149559You're really cringe
>>484149513N corp Grosshammer Meursault has a negative coin counter
>>484149559anon.you are cringe.
>>484147805>Scarecrow: Faust>Woodsman: Rodya>Scaredy Cat: Sinclair>Road Home: Outis / Hong Lu>Ozma: Yi Sang
>>484149513Minus coin ID are by default either going to be insanely broken damage machines or awful, as shown by those 2. So they're impossible to balance.Doing your max damage from the 1st coin is just too good.
>lugs around a thick metal shield and mace around like nothing>still gets manhandled by a fat commie that eats out of trash cans
>>484150382I want rodion to manhandle me...
>>484149513They don't know how to design themThey fucked up with NClair by making way to strong then fucked up with potential man by making him one of the worst ids in the gameSo they gave up on negative sanity id
>>484150571weirdly one of rodion's skills imply she was gonna be negative coin, even reinforced by her old base ego passive
>>484150571All Sunshower needed to be fine was a copy of NClair's half SP gain passive instead of relying on eating hits, his whole issue is that his SP gets too high.
>>484150382cute!!!!!!
>>484150571>>484150840SS heath was going to come out with a sanity rework where losing clashes meant your sinner lost sanity. So his S1 sucked ass so you could lose it and get sent to -30 sp because the hit would also chunk his sanity off the self sinking
>>484149162Yeah well we are not going to see him be a literal alien
>>484151072A reminder that we almost has SP be an engaging mechanic before the gacha coomers freaked out the second they lost a clash
Is this uptie at all worth it? It's the only thing on my sinking team that isn't Uptie/threadspin 4. Thread's always tight and it seems pretty inconsequential...
>>484152184TO BE FAIRplaying with the reworked sanity system sucked on release because you could anti-snowball into sinners constantly being in the negatives just by getting fucked from luckThe bull fight in story mode sucked because of this too
>>484152351the majority of U4s do nothing or are so little of a bonus it isnt worth it. Pretty much all core sinking ids can be ran at U3 and be fine
>>484152184A reminder that 50/50 gambling for the first 10 turns of each stage instead of only the first 2 or 3 is not more strategic or interesting, it's just more luck-based.
>>484152351No, not really.His III is enough.
>>484152184Losing clashes wouldn't be a bitch if most id's weren't made of paper
>>484152351His UT4 is just an expensive way to get a fancy border on his ID card
>>484152351Most U4s are a minor boost, with some IDs you don't need them at all
>>484113338>just realized RR4 will be all about distortionsfuck. fuuuuuuck.
>>484151072SS Heath works better with the current SP system, but he needs to build up towards it. Once his sinking stack is high enough, the greater SP gain actually benefits him more since it lets him balance out his SP loss with his gain better. His real issue has always been his slow startup. They tried rectifying it by personally giving him the ability to lose SP when he loses clashes, but even that’s pretty shitty since, not only is it a turn he does no damage, it’s also a turn where he takes damage. The gain is not at all equal to the opportunity lost. At any rate, even if the revamped SP system was kept, it wouldn’t have really helped.Honestly, at the time of his release, his damage was actually on the upper end of IDs once he got going, but his numbers have since quickly been powercrept to the point that it was just such a bad idea to lowball him so much on all the “buffs” he received. Aside from fixing the issues with his clash and damage, they need to skimp out less on the protection he receives, especially given how his stagger thresholds don’t fit his play style at all, and give him more sinking count and potency from his S1 and counter, since his only reliable way of building it up is his S3.
>>484152184It’s always the low IQ takes like this that remind me how very little qualifications some people have in this thread to ever seriously critique anything.
I fucking hate these dogshit rocks. Playing russian roulette out here trying to get Clean Mirror and I get the booger rock. This blows.
I really want envy peccas to be other player's ids that you set to fuck over other people. It will be so much fun to just fuck newfags into the dirtAlso I bet redditors will try some softball bullshit of purposefully equiping low level ids or something and seethe when they run up against k corp hong lu + nclaire + other cancer ids at U4 level 45
>rework the coin mechanic>all coins now have individual values and can independently be +/-/multiply
>>484154038You fockin' DONKEY
>>484154038I'd sooner assume they're just going to be structured and fixed encounters with different movesets than the base IDs.
>>484154690Yeah, that's what I was guessing, depressing though it may be. The idea of one day being able to use LV45 turbofuck IDs against other players is funny but too RNG-dependent for them to introduce in a fucking refraction railway.
Why are the Russian artists so goated?How do they do it?
>>484155615What do you mean?I know their PM wiki is a lot better than EN but that's honestly all what i know about them
>>484155954the ruski pm wiki is what a our PM encylopedia should belore about all of the concepts and rules of the city aswell as basic gameplay tips and such.arknights and type moon has it so we need to have a better standard
>>484156287No, i meant the art.What about that?
>>484156287Honestly, I think a general PM wiki that acts more as a City glossary than a game-specific encyclopedia is more than warranted at this point. But the current wiki space is super tumultuous and I bet it'd be hard to organize anyone onto a single one.
>>484155954Russian fan artists are consistently fucking good at drawing
>>484132498I'll claim 4...
>>484154038>pvp system added>its about sending work to dantes from other timesit kinda makes sense>>484154057we will get a match 3 puzzle before this
what if the head turns out to be a triumverant of lolibabas haha?
>>484148630Make me.
>>484156287>>484156549what's wrong with the english lob/ruina/lc/pm wikis other than being on fandom?though looking at it... i guess the lc wiki isn't that up-to-date
>>484156721RU is suffering, refined jewels come out of this
>>484158206The Lobcorp one is out of date since it was mostly sourced from the Russian one iirc, the Limbus one is chronically incomplete, and the Ruina one is inexplicably trying to become a general City wiki despite still going 100% all-in on the Library theming visually.And they're all on Fandom.Three wikis all intersecting in their coverage of one connected setting is interesting but ultimately inefficient; I think one unified and well-structured City Wiki would be nice to have.
>>484135220Ishmael and Don are really fucking hot in this pic
Lustful stare
Funny pre release everyone thought don would be flat, turns out she's a tiddy monster
>>484158594>thought ish would be B-C cups and don would be perflat>it's actually the exact oppositeweird world we live in
>>484158396thanks for the clarification, that makes a lot of senseI agree it would be neat to have a well made one-stop PM wiki but I don't personally have the energy to write it
>>484158580
>>484158594Don is flat in the LCB mirror world (only one that matters) though
>>484159079Shi? Her chestplate covers it up though
Speaking of ruskies;What happened with that bootleg LC datesim? It's still EA?
>>484159150Anon are you stupid
>>484158580>>484158837
I'm drunk. I fucked up and accidentaly uptied What is Cast instead of Rimeshank. 50 boxes in the drain.
>>484159359oh fuck forgotbut the game does show she has some chest, look at the canto 5 CG where she has a blobfish on her head
>>484159676>50 boxesso literally nothing?
*blocks your path*
>>484159676Eh, it's not like Rodion will get any Zayin EGO soon.
>>484159676you're ready for rodya's surprise ego scene in don's canto
>>484159676QUICK do 5 drunk runs to refill your boxes and you will forget your worries
>>484159676do a new account.
>>484159350if i had to guess it must be because putler's war is draining everyone's money and developersmost of that gose into the meatgrinder or his pockets that fuckerbut enoucgh about the upcoming great european war
sexoooooooooooooooooo
>>484159350Love Corp? Sort of.Added new route as far as i know.
>>484160872>it's not TipherethOne day... at least they made her sprite. That's something, I guess.
>>484160870Nice, it sucks that you only get one chance to see these animations in-game in their full glory, and wanting to re-view them can only be done in that static filtered PDA on the main menu
this thread isn't what it used to be, it's only about shipping and faggotry now, it's sad.
>>484161540*rapes you*
>>484162052
>>484162052If this bong rape me, I have no problem with that.
>>484162052show me this bongbongs asshole
>>484162396
>>484149397Wasn’t that thread before Limbus was announced? Why is Greg there… did we have his design in 2021?
Should I do the new manager rolls?Also when can I start events, i just completed chapter one
>>484158594tbf her front facing sprite doesn't show the curves of her breasts so people just assumed she was flat (people are still coping she is)
all the female sinners would be improved by being flat except for rodion DESU
>>484163156this but also rodion tits should triple in size
>>484163208gay shipping
>>484162959>did we have his design in 2021?Anon, i...
Should I be playing this on steam? It crashes all the time on my emulator.
>>484163715Uh, yeah.
>>484163802theres shrimp lore in LC?????
>>484163919The beta build but yes, it is shrimply necessary
>>484163715>playing a game via emulator than on steamare you retarded?
>>484163919Angela is pre-programmed with a built in funny commentary lexicon. It only knows marine puns. We do not know why
>>484163802
>>484164014I already had an emulator so I just figured it'd be fine to just download it there and get my mobage in the same place. I didn't think it'd crash so much.
>>484164110the ocean is cool
>>484164142Maybe the Head isn't wrong after all
>>484164316That's a prawnblematic opinion.
>>484127070Yes.>>484097134Very cute. I hope they had a meal too during the event.
>>484164961very nice
>>484164961>>484165059There were a bunch of cool pieces made at the time. Will share a few.
>>484165453based. The boorus had like 3 bhk images total last I checked
>>484165453>>484165579Ah, I see. That's odd because the art was ample. A shame others didn't save much.After the event dropped there was more interaction based art that dropped between he, Aeng-du and Jyun.
>>484165857
>>484166130
>it's another luxc where faust loses regret t1 t2 and distorts
>>484166423
>>484166680I'll leave it at that for now and share more later.
>>484166963very cool
>>484166963cool pits
GET THE FUCK HERE DANTE SHOWS UPhttps://cytube.implying.fun/c/vgleague
>>484167398Why the hell they turned Dante into fumo
>>484113338여보
>>484167398Why the fuck is dante part of the fumo general
>>484159758>>484159863>>484159868>>484159871>>484160393Good news is FINALLY seeing those sweet sweet deluge numbers.
>bp level 759>been rotating out my MD teams every team>almost always take the starlight rewards>do abno fights and such for bonus starlight instead of plain speedrunning>never buy starlight bonuses at the start of runs>still need 2700 starlight to finish the tree>never seen lunar memory either btw
New player here, is there any reason to fully clear every battle node in the story dungeon? Does it change for the Lux dungeon (which I haven't unlocked yet)?
>>484167398cute why though
>>484167740shuckaroonies good job anon>>484167797no, there is absolutely zero benefit to clearing extra battle nodesyou do not even get extra xp for it
>>484167797>is there any reason to fully clear every battle node in the story dungeon?No.But you might check all "?" for extra boosts
The blunt and pierce category has some good giftsSlash doesn’t have a single good one, it’s crazyMoment of sentencing is worse than keen branch and clasped handsThe tier 4 gift is the worst of them allOnly scissors is “kinda” good in a poise team
>>484167398Oh someone beat me to it. Anyway, congrats to /gbfg/ for winning /vg/ League 22, now come watch Fumo Dante smack them about alongside more fumos. See you guys for whenever the next league or invitaitonal is.
>>484168084the tier 2 slash one gives +2 clash power which is pretty great
>>484168217see you later space cowboy
Fumanteh sex
>>484168217i'm gonna fuck that manager fumo
>>484168217kys
JULY 1STALL THE FAGGOTS TO THE BACK
>>484168217Take care bro.
>>484169479I'm 100% back.
>>484168750fumanteh is so cute bros...
Nice and long ejaculation. Really felt the extra pulses. Time for a nap
>>484171052giwtwm
>>484171052cute
>>484169809
Why is catshu so mad?
>>484169809You're 100% black.
HE SCORED
>>484113338>thread made late last night >still aroundHoly shit. The content drought leading up to Time Killing Time really neutered this place, huh
>>484172309And it will get worse.
>>484172267he's pretty cool
>>484172309Personally I've been doing lots of writing and playing Dawntrail to really participate in the bread.
>>484172309I've been super busy IRL but hopefully will be able to take requests again sometime soon.
>>484172309I've been too busy doing lots and lots of sex with real women in real life to post much, I don't see it letting up any time soon either so wish me luck.
>>484173210didn't this guy make the trans love bongbong
>>484173423of course. don't you know what type of "women" that anon is referring to?
>>484172309Sorry, I've been busy with some paperwork since I won the lottery, 5 million!
>>484172309/lcg/ is reclining...
>>484172309There's been other big video game releases and not much to talk about with this one what do you expect
>>484173623Good work, anon!
>>484172309I've been busy playing Kenshi, and I don't post that often anyways.
>>484172309Limbus being shit and threads being shit neutered pm thread, yes.
>>484174798>spoilerBased and same
Pride month has killed /lcg/ spirit.
>>484172309You could always post some art to revive people's vigor, I guess...
>>484175403Thankfully Envy is right around the corner.
>>484172309I'm not a professional at finding topics to discussI am however just a grade 9 Limbus spender
Anybody going to AX?I'm going to be a w corp janny and it'd be a shame if nobody there recognizes it
It's now official Limbabs, we're making the /vg/ Roster for the third time in a row (due to technicalities). Our boy DEFRAUDED will be joining the /vg/ team as a bench CB so hopefully he makes a showing or two. It's late right now so tomorrow I'll make a brief post about the future of the team and where we're going from now on alongside making a few executive managerial decisions regarding the team when regarding roster polls and what not.
Isn't it weird that Gregor lost control of his arm only once in a flashback, and it's apparently never been an issue since?
>>484176597I could take them on
>They update MD to give the player higher chances to build what they want>3 resets later, I still don't get Bamboo Hatted Kim's theme for the BL gifts (doing compendulum comlpetion)Thanks PM...
Do you have a pic with the recipes for EGO gifts fusion? Shit is kinda hard to find online.
>>484177691I can't relateRAPE RAPE
I despise bleed as a status exclusively for how frequently it fucks my solos. I'm surprised PM hasn't introduced some purify mechanic to put on bosses/ego yet.
I got all the new tremor ids but is it really worth it to spend thread on them? I'm thinking I'd rather focus on good generic ids still
>>484179506did a 4th time and still nothing, fuck this game lol
Tremor is so fucking fun bros. Absolutely amazing to see enemies utterly implode at the end of the turn. Hope Wapeepoo comes soon because I'm still missing EGO Paus.
If I just want a clear, what team has the easiest time in RR?
>>484180268Sinking for no-SP enemies
>>484180268a bunch of genericaly good pierce ids + sinking
>>484177054whoooooooooooosleep well manager
>>484176597my type
>>484179506lucky slut
what color will we see next in Don's chapter?
>>484145538I have seen every sinner shipped with every other sinner.
>>484182912The White Moon.
I'm pretty sure I've never seen anyone ship Heathcliff and Outis.
>>484177691You might already know this, but you can actually combine gifts on his floor to get the specific gifts for the fusion you want. I managed to get one of the refracted blades by doing that.
>>484183889I have read porn of futa GCorp Outis raping Rabbit Heath and filling him up
>>484177691i'm being big fucking skill issued by all the new md fusions, i haven't gotten the rng to make a single one even when i intentionally sink my run to fish for them
>>484182925Post one Ish/Meursault drawing
>>484184475wtf how? Its pretty easy to get every single gift of a category by floor 4 and you can get all the fusions on floor 3 at the latest
>>484184697left side? easy, every single run. everything on the right side? i'll get one half but never see the other. i don't know man
>>484182912>Vermilion jobbed so hard he doesn't get included to the comp art.
>>484184906yeah the right side is complete bullshit you either get on floor 5 or not at all lol
Why does Ishmael entertain this 45 year old hags deluded schoolgirl fantasies?
>>484184948to be fair he doesnt even have a design all we know is his cross and he had long hair
Just finished reading The Stranger. Its kino. Project moon skip Don's Canto and just do Meursault's instead.
did we like june?
>>484185608Wouldn't they have to skip Don and Hong to get to Meursault
>>484185632there is a delicious tang of irony to tying a faggot fundraiser to celebrating the literal sin of pride.
>>484185632how come Zet isn't in this?
>>484184310
Awful slow lately huh limbabs? Have some tuber pit to lift your spirits up.
>>484186534thank you anon I enjoy this tuber and this pit
did we have a match today? did I miss another one?how the fuck are we even doing?
>>484186745there was a match a few days ago that we lost but other than that there was the GOAT fumanteh
>>484185632who's june
>>484182925Post 1 (uno) pic of Hong Lu x Don
>>484186684You're very welcome anon.
>>484184310source?
>>484168217Wait, when did we lose?
Dead period
Literally every Sinner belongs to Dante, and shippers will fucking explode once they find out.
>>484177054Of course we send DEFRAUDED considering we frauded our way into that spot, that's hilarious.
>>484186534It will all be daijobu when we have Railway content in a few days
>think don and sinclair are the same height>sinclair's actually a little bit tallerWhat a fucking joke. This game is genuinely shit.
>>484188342I give the general three days before it turns back to off topic posting. How long did TKT discussion last again? I feel like other gacha generals stay on topic far more. I wonder if we just have more people itching for the chance to talk about anything else?I say, posting a VTuber.
>>484188442Males taller than females? Imposible!
>>484188442niggerfaggot
How do you consistently get big numbers with Everlasting Faust? I usually get ~250 damage whenever I use her, even with Sloth Abs. Res.
>>484188916tremor reverb bwo
>>484188916use hong lu frog before hand
>>484188916Set up pee flavor Tremor first with Hong Lu, cum flavor will combine the Tremor types so when it procs extra bursts, all of the bursts will deal damage
>>484189017Ah, I don't have him yet. I'll shard it.
>>4841889183 more days vidya boobs
>>484188594>outis and rodya are taller than sinclair
>>484184619
>>484187093
>>484189763The 2 most autistic sinners..
>>484189354You forgot to add Ishmael and Ryoshu as well.
>>484188916trigger hong lu's 3rd skill first which makes all different tremor types active, then have faust's ego win the 50/50 flip to trigger tremor burst twice up to 8 times and you'll get 1k+ damage easy
Paus
>>484190120shut up paus my point still stands
>>484189354>Charon is taller than Don and Sinclair
>>484120873Pretty much. The doomposting is palpable
*slurp*
Would you date a Cathy?
>>484191310I would be the Cathy to a Heath
>>484191302Don't make me vomit.
>>484191302Faust's husband
superiority breeds jealousy
>>484191310Online dated one once, I do not have the energy to keep up with someone as high maintenance as that.
>>484190621Why don't we expand the list beyond sinners? Charon, Yuri, Hermann, Saude, Kromer, Ran, Dongbaek, Ahab, Queequeg, Caiman, Mai, and Aeng-du (yes, even her!) are all taller than Sinclair. He might be taller than Shrenne, I don't remember.
*shlurp*
>>484191310pouting is cute, I could take it
>See EGO Gift on floor set>Reach end of it to get the Gift>''Damage taken by enemies -5%''It just happens every time...
>>484191664aex
>>484191302
>>484191958
>>484191310Fuck noDeath was too good of a punishment
>Did not gain an EGO gift >Did not gain an EGO gift >Did not gain an EGO gift >Did not gain an EGO gift IT FUCKING IS 33% OR 50% CHANCE HOW DOES IT FAIL EVERY SINGLE TIMEFUCKING DARKEST DUNGEON/POKEMON SHIT CHANCES
>>484191310I have a wife
>>484192363NEXT TIMENEXT TIME FOR SURE
>>484192157Nelly....
>>484192363aw dangit
>>484192363try again you will get it this time
cashy..they're laser torturing me nowthey say its to fix my eyesightbut I know it's just to remove my memories of youI need to see yousave me from these lunaticspleasecashy...
>>484192746I love men in black
>>484192746heisuuu ;;
>>484192746I kinda wish the real Heath would have a moment like this in the story. Where he's waxing prose about Cathy as his life is miserable but its just Rodion has him in a headlock or something.
>>484192363I can't believe I miss Roland.
>>484193137that would be hilarious and cute>>484193187I miss him too... I can't wait for his inevitable announcer, I want to hear him again.
holy shit the 3 shi ids with their slash gift is fun as fuck in mirror dungeons
>>484192363Keep gambling
Can I kill goycum with these or do I need to restart RR3
>>484193187>>484193383>Roland announcer>It's just him talking about HHPP sandwiches in all the lines of dialogue.
>>484193762You should be able to but it'll be annoying I'm sure. Your sinners will reset next node so you don't have to worry about their sanity or them dying either.
>>484193762Support someones Pointy Sang in with your schizo team, should work well
>>484193873i'd give anything for lol& sandwich man
It's beena whole yearyou are finally mine you slippery bastard
>>484194745based. congrats anon. i've not found it yet with the new mds
>>484193873>His dialogue is regularly updated to reference the latest HHPP events and invite people to visit
Did he ever get to hit the Cathussy?
I like using the new Dyon in Exp Lux
>>484195192she's a fun ID for sure
>>484194745congrats, welcome to the club.
>>484194372I forgot you could use support sinners
>>484194880>Roland at one point would advertise this
>>484195182The Cathussy was never touched not even by Cathy as she was saving herself for HeathThe Nellyussy tho? She used lil heath's dick everyday
>DEEPYETFAINGLOOMYYETMERRYFRIGIDYETWARMSHARPYETSOFTCOOLYETSWELTERING>everyone in thread takes 25HP DMG
>>484189763Hes ishmaels pillow since he doesnt have a real reason to protest or move from his spot
pitsmellmael my beloved
Would you have been okay with Ishmael having a character development haircut like some people predicted before Canto 5?
>>484190043Good job
>>484196327No. Her majestic mane is her charmpoint and the only thing that distinguishes her from dime a dozen tsunderes.
Many very horny today. Ejaculation was very smooth right mix of pressure and length. Real sleepy now
I miss Sinclair...
had my 21st birthday today, superdrunk, comfy and cozy. is kjh going to give me some exciting RR4 teasers as a present today?
>>484196402Bed breaking hip replacing sex with old women.
>>484113881OH TO BE A FLESHY THING
>>484197085happy happy birthday anon!who is your fav sinner?
>>484197071me too. it's too bad sinclair is never getting content ever again. this truly is eos
>>484197670I like merusault. unbelievably excited for his canto, he constantly steals the spotlight in any scene he's in
>>484197806Didn't that lil nigga just get a 000 and a new ego? Fuck you we need Ishtent
>>484197879incredibly basedhope you stay comfy and have a good day bro, happy bday again
>>484198190thank you thank you, dreading staying up until the early morning for the news but I gotta do it
>>484197125So true!Add on for the purpose of procreation even though it's nigh impossible
>>484198308at least you won't be alone!
>>484197806>>48419793400 Wclair or we burn this game to the ground again. And it BETTER be a Tomerry ID.
>accidentally selected Sinclair as an announcerDang what a cutie he is.
>>484199164sinclair is for dante (me) only
>look inside boolet outis' asset folder>the entirety of her base id is inside alongside the shootis assets>all it would take is one digit increasing by 1 for all her sprite animations to swap to her base idI bet you this will be something we get lunacy for in the future
why is Dante such as asshole?
>>484199509I mean, any ID could have their sprite's target files change by accident and fuck them up
>>484199653his real personality is starting to reassert itself
>>484199945kngh!
>>484199296Wrong. Sinclair is for me.
He is literally me holy shit
>>484200197<Leave my chips alone, mirror-me! This is *my* sinclair to prostate milk!>
>>484192363
>Game is deadWhat went wrong, limbabs
>>484200679i'm playing it rn though
>>484199653>Two separate scenes where he misses a blonde and brunette twinkWhy is he such a faggot holy shit?
>>484200790What if Dante isn't a faggot though
>>484200679EoS...
>>484201197P.H.P
>>484201503
>>484148414Sinclair would get Courage/Scaredy Cat
sleep timegon frens
>>484148414Alternative would be Meursault getting Woodsman and Rodya the adult who lies.
gn /lcg/
>>484204010>>484204257sweet dreams limbers
Which pocketwatch is best pocketwatch?
>>484205063I wish I knew
Funny theory I have:Sonya was initially influenced by Carmen. Not however by crazy voice in head Carmen but he was inspired by her pre lob corp during the time she was wandering around in the city finding other people for her cause.
>>484205982BEHOLDTHE SILLIEST SINNER
>>484200679Just do your daily MD runs.Tremor is the probably the most fun team to run at the moment. What do you guys think?
Do we agree that PM lost its edge in its characters?
>>484200679because am busy playing it instead of talking to you braindead
>>484206832What is this some sort of attempt at discussion?
>>484200679>me on the left about to be massacred by RyoshuTotal bliss
Your dog doesn't love you. It's just an animal seeking food and shelter
>nyes dyante, meowst knyos what meowst knyos
Attention /lcg/Carmen forcefield
Thoughts on the concept incinerator?
>>484207241My dog loves me BECAUSE i provide it with food and shelter
>thread is so dead we're resorting to ancient ragebaits for a sliver of trafficWhere's the futafag avatar and Shitclairposter?
Thoughts?
the dark days are not responsible for 100% of distortions
wuthering heights taught me that marriage is not an obstacle to love
>>484207673can't believe they gave it the fix it needed this season
>be the black silence>fight distrotion>die>be an average grade 9 fixer>fight the same distortion>winwhat did PM mean by this?
>>484207779Reading the bible should have taught you that.
>>484207785They did the same with the Charge fusion gift. Previously, the DMG up only lasted for turn 1 and it was only 20%. The rest of the kit was Offensive Level oriented
Best mods to beat Lobcorp? I hate this game and I wanna be done with it.
>>484207848but the christians keep telling me that marriage is sacred...
>>484207915Lewd mod
Today I was reminded of how amazing MySpace profile customization was and desperately wanted it back with current social media sitesBut then I remembered that it would be a terrible idea since companies will have an easier time harvesting your information and sell it to the chinksDon't let anyone tell you it's nostalgia. Old internet was a thousand times better than current internet
>>484207241men and women can't be friends do women really? fatfags vs. armpitfags vs. footfags vs. futafags monolithconcept incineratortwitterfags can nuggets beat the headshippingdid I miss anything?
If Outis has a wife I'm going to fuck her.If Outis has a husband I'm going to fuck him.
>>484208132ShitclairMagical Girl avatarForcefieldUhhhh
>>484208030Read the bible then. Or just literally look up what Jesus says about marriage.
>>484208272What Jesus said or what one of his disciples claim that Jesus said with no source to back it up? Those two are very different things
>>484208272Doesn't really say anything about it in here.
Post Ryoshu's feetPlease...
>>484208132Waifufags but those got purged ages agoIm pretty sure Nfaust culled them all
>>484208272>Ye have heard that it was said by them of old time, Thou shalt not commit adultery:>But I say unto you, That whosoever looketh on a woman to lust after her hath committed adultery with her already in his heart.Jesus seems to really hate adultery.
>>484208517>Ryoshu doesn't have a childNo, they're still around
sexmael
Baking new Bread.Will share on page 5.
>>484208517N Faust is for (You), though?
>>484208562He sounds kind of based
>>484207241and? they still has more quality and use then you ever be in life
>>484208612Heathcliff is such a lucky guy
>>484208573That's just an observation.I still don't think they will pull it off.Im more interested in the whole Outis debacle if I say so myself>>484208663I don't take any dante ship seriously.
>>484208872>shipping sinners with DanteCring>shipping sinners with meBased
>>484208939Oh that's OC territory. So even more cringe.
All the sinners are for (You). Sinner ships not involving Dante are genuine cuckshit.
>>484208872Dante ships are the only ships to take seriously, DESUThe manual even says that your goal is to get close to your Sinners' hearts, and Dante has had a LOT of heart to heart conversations with most of them already.
>>484208803cuck
>>484208562Yes. Yet it also completly denies any notion that it would stay as a vow in the afterlife.
>>484209323>>484209323>>484209323
My first max threadspin!
>>484209194I AM HEATHCLIFF
